Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 3768191..3768755 | Replicon | chromosome |
| Accession | NZ_CP112868 | ||
| Organism | Pseudomonas quebecensis isolate S1Bt3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OSC49_RS17205 | Protein ID | WP_266246111.1 |
| Coordinates | 3768468..3768755 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OSC49_RS17200 | Protein ID | WP_181081261.1 |
| Coordinates | 3768191..3768478 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSC49_RS17165 (OSC49_17165) | 3763303..3764082 | - | 780 | WP_181081266.1 | amino acid ABC transporter ATP-binding protein | - |
| OSC49_RS17170 (OSC49_17170) | 3764085..3764861 | - | 777 | WP_266246104.1 | amino acid ABC transporter permease | - |
| OSC49_RS17175 (OSC49_17175) | 3764873..3765679 | - | 807 | WP_266246106.1 | ABC transporter substrate-binding protein | - |
| OSC49_RS17180 (OSC49_17180) | 3765741..3766409 | - | 669 | WP_253508486.1 | GntR family transcriptional regulator | - |
| OSC49_RS17185 (OSC49_17185) | 3766493..3766801 | - | 309 | WP_266246108.1 | hypothetical protein | - |
| OSC49_RS17190 (OSC49_17190) | 3767000..3767425 | + | 426 | WP_253508488.1 | hypothetical protein | - |
| OSC49_RS17195 (OSC49_17195) | 3767477..3767794 | - | 318 | WP_034099046.1 | transcriptional regulator | - |
| OSC49_RS17200 (OSC49_17200) | 3768191..3768478 | + | 288 | WP_181081261.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OSC49_RS17205 (OSC49_17205) | 3768468..3768755 | + | 288 | WP_266246111.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSC49_RS17210 (OSC49_17210) | 3768794..3769570 | - | 777 | WP_266246113.1 | DUF1828 domain-containing protein | - |
| OSC49_RS17215 (OSC49_17215) | 3769570..3770085 | - | 516 | WP_266246114.1 | hypothetical protein | - |
| OSC49_RS17220 (OSC49_17220) | 3770130..3770366 | - | 237 | WP_266246115.1 | hypothetical protein | - |
| OSC49_RS17225 (OSC49_17225) | 3770622..3770843 | + | 222 | WP_266246116.1 | hypothetical protein | - |
| OSC49_RS17230 (OSC49_17230) | 3770893..3771117 | + | 225 | WP_266246118.1 | Arc family DNA-binding protein | - |
| OSC49_RS17235 (OSC49_17235) | 3771114..3771281 | + | 168 | WP_266246119.1 | hypothetical protein | - |
| OSC49_RS17240 (OSC49_17240) | 3771274..3771621 | + | 348 | WP_266246121.1 | hypothetical protein | - |
| OSC49_RS17245 (OSC49_17245) | 3771914..3773098 | + | 1185 | WP_266246122.1 | tyrosine-type recombinase/integrase | - |
| OSC49_RS17255 (OSC49_17255) | 3773348..3773704 | - | 357 | WP_003174972.1 | MerR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3767996..3778697 | 10701 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10987.84 Da Isoelectric Point: 10.2255
>T264898 WP_266246111.1 NZ_CP112868:3768468-3768755 [Pseudomonas quebecensis]
MAAEYEVEWDPKALKELRKLDGTIRLQFLKKLQERQSGPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDERIVILVLAV
GKRERGSVYEQAGKR
MAAEYEVEWDPKALKELRKLDGTIRLQFLKKLQERQSGPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDERIVILVLAV
GKRERGSVYEQAGKR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|