Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA(toxin) |
Location | 2479376..2479986 | Replicon | chromosome |
Accession | NZ_CP112868 | ||
Organism | Pseudomonas quebecensis isolate S1Bt3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2G0WYT7 |
Locus tag | OSC49_RS11455 | Protein ID | WP_034096965.1 |
Coordinates | 2479735..2479986 (-) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OSC49_RS11450 | Protein ID | WP_181077070.1 |
Coordinates | 2479376..2479738 (-) | Length | 121 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSC49_RS11435 (OSC49_11435) | 2475468..2476298 | + | 831 | WP_253506786.1 | IclR family transcriptional regulator | - |
OSC49_RS11440 (OSC49_11440) | 2476522..2477721 | + | 1200 | WP_266248926.1 | hypothetical protein | - |
OSC49_RS11445 (OSC49_11445) | 2477872..2479227 | + | 1356 | WP_181077068.1 | MATE family efflux transporter | - |
OSC49_RS11450 (OSC49_11450) | 2479376..2479738 | - | 363 | WP_181077070.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OSC49_RS11455 (OSC49_11455) | 2479735..2479986 | - | 252 | WP_034096965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9497.05 Da Isoelectric Point: 10.0458
>T264897 WP_034096965.1 NZ_CP112868:c2479986-2479735 [Pseudomonas quebecensis]
VSKNEKLLAKLLNEQMAFTWPELVTLLRRLGYTQIEGAGSRVKFDSGDPTAMITLHKPHPGNELKHYIRRQIIEQLKSGE
LIQ
VSKNEKLLAKLLNEQMAFTWPELVTLLRRLGYTQIEGAGSRVKFDSGDPTAMITLHKPHPGNELKHYIRRQIIEQLKSGE
LIQ
Download Length: 252 bp
Antitoxin
Download Length: 121 a.a. Molecular weight: 13248.06 Da Isoelectric Point: 6.7446
>AT264897 WP_181077070.1 NZ_CP112868:c2479738-2479376 [Pseudomonas quebecensis]
VNNQLKHKGYIGSIEASLEDNCLFGKILFIKALISYEGKTVADLDAAFQEAVDDYLVTCQNLGQTPEKPCKGSFNVRVGH
DLHLAAALAATRRKVTLNDLTRQALNEFLQHHFAELHPSA
VNNQLKHKGYIGSIEASLEDNCLFGKILFIKALISYEGKTVADLDAAFQEAVDDYLVTCQNLGQTPEKPCKGSFNVRVGH
DLHLAAALAATRRKVTLNDLTRQALNEFLQHHFAELHPSA
Download Length: 363 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|