Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 52645..53164 Replicon plasmid unnamed3
Accession NZ_CP112865
Organism Enterococcus faecium strain DVT1681

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag OSG99_RS16190 Protein ID WP_000588503.1
Coordinates 52907..53164 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag OSG99_RS16185 Protein ID WP_000388479.1
Coordinates 52645..52914 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSG99_RS16155 (OSG99_16155) 48211..48843 + 633 WP_002311505.1 HAD family phosphatase -
OSG99_RS16160 (OSG99_16160) 49742..50569 + 828 WP_002322453.1 helix-turn-helix domain-containing protein -
OSG99_RS16165 (OSG99_16165) 50592..51240 - 649 Protein_64 IS6 family transposase -
OSG99_RS16170 (OSG99_16170) 51355..51954 + 600 WP_011117472.1 hypothetical protein -
OSG99_RS16175 (OSG99_16175) 52119..52319 + 201 WP_001033544.1 4-hydroxybenzoate octaprenyltransferase -
OSG99_RS16180 (OSG99_16180) 52335..52514 + 180 WP_001120991.1 hypothetical protein -
OSG99_RS16185 (OSG99_16185) 52645..52914 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OSG99_RS16190 (OSG99_16190) 52907..53164 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
OSG99_RS16195 (OSG99_16195) 53623..54627 + 1005 WP_000455809.1 hypothetical protein -
OSG99_RS16200 (OSG99_16200) 54792..55406 - 615 WP_001261742.1 recombinase family protein -
OSG99_RS16205 (OSG99_16205) 55856..57181 + 1326 WP_000969590.1 Y-family DNA polymerase -
OSG99_RS16210 (OSG99_16210) 57174..57524 + 351 WP_000568378.1 hypothetical protein -
OSG99_RS16215 (OSG99_16215) 57521..57700 + 180 WP_001021554.1 hypothetical protein -
OSG99_RS16220 (OSG99_16220) 57836..58126 + 291 WP_000026576.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid erm(B) / ant(6)-Ia / VanHAX / aac(6')-aph(2'') - 1..59943 59943
- flank IS/Tn - - 50592..51155 563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T264892 WP_000588503.1 NZ_CP112865:52907-53164 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT264892 WP_000388479.1 NZ_CP112865:52645-52914 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References