Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 40313..40832 Replicon plasmid unnamed3
Accession NZ_CP112865
Organism Enterococcus faecium strain DVT1681

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag OSG99_RS16115 Protein ID WP_000588503.1
Coordinates 40575..40832 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag OSG99_RS16110 Protein ID WP_000388479.1
Coordinates 40313..40582 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSG99_RS16070 (OSG99_16070) 35388..35570 + 183 Protein_45 hypothetical protein -
OSG99_RS16075 (OSG99_16075) 36070..36750 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
OSG99_RS16080 (OSG99_16080) 36792..37394 + 603 WP_267132961.1 Fic family protein -
OSG99_RS16085 (OSG99_16085) 37410..37982 + 573 WP_000170424.1 recombinase family protein -
OSG99_RS16090 (OSG99_16090) 38228..38908 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
OSG99_RS16095 (OSG99_16095) 39023..39622 + 600 WP_011117472.1 hypothetical protein -
OSG99_RS16100 (OSG99_16100) 39787..39987 + 201 WP_001033544.1 4-hydroxybenzoate octaprenyltransferase -
OSG99_RS16105 (OSG99_16105) 40003..40182 + 180 WP_001120991.1 hypothetical protein -
OSG99_RS16110 (OSG99_16110) 40313..40582 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OSG99_RS16115 (OSG99_16115) 40575..40832 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
OSG99_RS16120 (OSG99_16120) 40953..41558 + 606 WP_000599739.1 Fic family protein -
OSG99_RS16125 (OSG99_16125) 41574..42146 + 573 WP_000170424.1 recombinase family protein -
OSG99_RS16130 (OSG99_16130) 42392..43072 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
OSG99_RS16135 (OSG99_16135) 43146..43514 + 369 Protein_58 PTS sugar transporter subunit IIC -
OSG99_RS16140 (OSG99_16140) 43528..44340 + 813 WP_002298371.1 PTS system mannose/fructose/sorbose family transporter subunit IID -
OSG99_RS16145 (OSG99_16145) 44394..45359 + 966 WP_002371739.1 SIS domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid erm(B) / ant(6)-Ia / VanHAX / aac(6')-aph(2'') - 1..59943 59943
- inside IScluster/Tn erm(B) / ant(6)-Ia / VanHAX / aac(6')-aph(2'') - 1657..43078 41421


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T264891 WP_000588503.1 NZ_CP112865:40575-40832 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT264891 WP_000388479.1 NZ_CP112865:40313-40582 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References