Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 494750..495321 | Replicon | chromosome |
| Accession | NZ_CP112862 | ||
| Organism | Enterococcus faecium strain DVT1681 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | OSG99_RS02325 | Protein ID | WP_002286801.1 |
| Coordinates | 494980..495321 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | OSG99_RS02320 | Protein ID | WP_002323011.1 |
| Coordinates | 494750..494980 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSG99_RS02295 (OSG99_02295) | 490231..491559 | + | 1329 | WP_002327434.1 | FAD-containing oxidoreductase | - |
| OSG99_RS02300 (OSG99_02300) | 491581..492207 | + | 627 | WP_002352507.1 | cysteine hydrolase | - |
| OSG99_RS02305 (OSG99_02305) | 492390..492971 | + | 582 | WP_002327433.1 | TetR/AcrR family transcriptional regulator | - |
| OSG99_RS02310 (OSG99_02310) | 493336..493911 | + | 576 | WP_002352505.1 | SOS response-associated peptidase family protein | - |
| OSG99_RS02315 (OSG99_02315) | 494116..494454 | - | 339 | WP_002306002.1 | hypothetical protein | - |
| OSG99_RS02320 (OSG99_02320) | 494750..494980 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| OSG99_RS02325 (OSG99_02325) | 494980..495321 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OSG99_RS02330 (OSG99_02330) | 495656..496113 | + | 458 | Protein_462 | transposase | - |
| OSG99_RS02335 (OSG99_02335) | 496208..497167 | + | 960 | WP_002301399.1 | IS30 family transposase | - |
| OSG99_RS02340 (OSG99_02340) | 497173..497883 | + | 711 | Protein_464 | IS3-like element IS1485 family transposase | - |
| OSG99_RS02345 (OSG99_02345) | 498014..498256 | + | 243 | Protein_465 | LPXTG cell wall anchor domain-containing protein | - |
| OSG99_RS02350 (OSG99_02350) | 498330..499226 | + | 897 | WP_002352497.1 | class C sortase | - |
| OSG99_RS02355 (OSG99_02355) | 499407..500081 | + | 675 | WP_002291233.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 490231..521605 | 31374 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T264890 WP_002286801.1 NZ_CP112862:494980-495321 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |