Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 494750..495321 Replicon chromosome
Accession NZ_CP112862
Organism Enterococcus faecium strain DVT1681

Toxin (Protein)


Gene name mazF Uniprot ID Q3Y2B8
Locus tag OSG99_RS02325 Protein ID WP_002286801.1
Coordinates 494980..495321 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A828ZZN9
Locus tag OSG99_RS02320 Protein ID WP_002323011.1
Coordinates 494750..494980 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSG99_RS02295 (OSG99_02295) 490231..491559 + 1329 WP_002327434.1 FAD-containing oxidoreductase -
OSG99_RS02300 (OSG99_02300) 491581..492207 + 627 WP_002352507.1 cysteine hydrolase -
OSG99_RS02305 (OSG99_02305) 492390..492971 + 582 WP_002327433.1 TetR/AcrR family transcriptional regulator -
OSG99_RS02310 (OSG99_02310) 493336..493911 + 576 WP_002352505.1 SOS response-associated peptidase family protein -
OSG99_RS02315 (OSG99_02315) 494116..494454 - 339 WP_002306002.1 hypothetical protein -
OSG99_RS02320 (OSG99_02320) 494750..494980 + 231 WP_002323011.1 hypothetical protein Antitoxin
OSG99_RS02325 (OSG99_02325) 494980..495321 + 342 WP_002286801.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OSG99_RS02330 (OSG99_02330) 495656..496113 + 458 Protein_462 transposase -
OSG99_RS02335 (OSG99_02335) 496208..497167 + 960 WP_002301399.1 IS30 family transposase -
OSG99_RS02340 (OSG99_02340) 497173..497883 + 711 Protein_464 IS3-like element IS1485 family transposase -
OSG99_RS02345 (OSG99_02345) 498014..498256 + 243 Protein_465 LPXTG cell wall anchor domain-containing protein -
OSG99_RS02350 (OSG99_02350) 498330..499226 + 897 WP_002352497.1 class C sortase -
OSG99_RS02355 (OSG99_02355) 499407..500081 + 675 WP_002291233.1 response regulator transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 490231..521605 31374


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13302.68 Da        Isoelectric Point: 9.9044

>T264890 WP_002286801.1 NZ_CP112862:494980-495321 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.39 Da        Isoelectric Point: 3.9078

>AT264890 WP_002323011.1 NZ_CP112862:494750-494980 [Enterococcus faecium]
MLVTKSRLQGSSVVVTLPSDNGKKPSENQEYIVVYSDDGTITLVPKIEDPFSGGEEAEYYEKDEWEDLTPEGREIL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FD66

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZZN9

References