Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3358309..3358962 | Replicon | chromosome |
| Accession | NZ_CP112859 | ||
| Organism | Acinetobacter baumannii strain EAB1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OPM65_RS15825 | Protein ID | WP_000607077.1 |
| Coordinates | 3358309..3358698 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OPM65_RS15830 | Protein ID | WP_001288210.1 |
| Coordinates | 3358705..3358962 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPM65_RS15810 (OPM65_15810) | 3353427..3355622 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
| OPM65_RS15815 (OPM65_15815) | 3355810..3356376 | - | 567 | WP_000651538.1 | rhombosortase | - |
| OPM65_RS15820 (OPM65_15820) | 3356454..3357539 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| OPM65_RS15825 (OPM65_15825) | 3358309..3358698 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
| OPM65_RS15830 (OPM65_15830) | 3358705..3358962 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OPM65_RS15835 (OPM65_15835) | 3359150..3360322 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| OPM65_RS15840 (OPM65_15840) | 3360371..3361861 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OPM65_RS15845 (OPM65_15845) | 3362043..3362420 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OPM65_RS15850 (OPM65_15850) | 3362439..3363446 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T264887 WP_000607077.1 NZ_CP112859:c3358698-3358309 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|