Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2220566..2221167 Replicon chromosome
Accession NZ_CP111147
Organism Pasteurella multocida strain PF11

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag ORU98_RS10815 Protein ID WP_078819687.1
Coordinates 2220853..2221167 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ORU98_RS10810 Protein ID WP_078819686.1
Coordinates 2220566..2220856 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORU98_RS10775 (ORU98_10775) 2215592..2215807 - 216 WP_075271368.1 hypothetical protein -
ORU98_RS10780 (ORU98_10780) 2215804..2216487 - 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
ORU98_RS10785 (ORU98_10785) 2216545..2216994 - 450 WP_099821840.1 YmfL family putative regulatory protein -
ORU98_RS10790 (ORU98_10790) 2217043..2217243 - 201 WP_099821841.1 YdaS family helix-turn-helix protein -
ORU98_RS10795 (ORU98_10795) 2217368..2218051 + 684 WP_099821842.1 S24 family peptidase -
ORU98_RS10800 (ORU98_10800) 2218262..2220106 + 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
ORU98_RS10805 (ORU98_10805) 2220136..2220540 + 405 WP_146024473.1 hypothetical protein -
ORU98_RS10810 (ORU98_10810) 2220566..2220856 - 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
ORU98_RS10815 (ORU98_10815) 2220853..2221167 - 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORU98_RS10820 (ORU98_10820) 2221473..2221640 - 168 WP_005756653.1 DUF1508 domain-containing protein -
ORU98_RS10825 (ORU98_10825) 2221653..2221862 + 210 WP_005756656.1 hypothetical protein -
ORU98_RS10830 (ORU98_10830) 2222104..2222334 + 231 WP_078737821.1 hypothetical protein -
ORU98_RS10835 (ORU98_10835) 2222347..2222517 + 171 WP_225529669.1 hypothetical protein -
ORU98_RS10840 (ORU98_10840) 2222498..2222692 - 195 WP_014391459.1 hypothetical protein -
ORU98_RS10845 (ORU98_10845) 2223056..2223424 + 369 Protein_2090 Bro-N domain-containing protein -
ORU98_RS10850 (ORU98_10850) 2223674..2224330 + 657 WP_225529682.1 KilA-N domain-containing protein -
ORU98_RS10855 (ORU98_10855) 2224392..2224622 - 231 WP_223251317.1 hypothetical protein -
ORU98_RS10860 (ORU98_10860) 2224770..2225069 + 300 WP_078802174.1 hypothetical protein -
ORU98_RS10865 (ORU98_10865) 2225041..2225277 + 237 WP_075271355.1 hypothetical protein -
ORU98_RS10870 (ORU98_10870) 2225290..2225577 + 288 WP_014391452.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2180720..2233017 52297


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264886 WP_078819687.1 NZ_CP111147:c2221167-2220853 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264886 WP_078819686.1 NZ_CP111147:c2220856-2220566 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References