Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2220566..2221167 | Replicon | chromosome |
| Accession | NZ_CP111147 | ||
| Organism | Pasteurella multocida strain PF11 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ORU98_RS10815 | Protein ID | WP_078819687.1 |
| Coordinates | 2220853..2221167 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ORU98_RS10810 | Protein ID | WP_078819686.1 |
| Coordinates | 2220566..2220856 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU98_RS10775 (ORU98_10775) | 2215592..2215807 | - | 216 | WP_075271368.1 | hypothetical protein | - |
| ORU98_RS10780 (ORU98_10780) | 2215804..2216487 | - | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU98_RS10785 (ORU98_10785) | 2216545..2216994 | - | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| ORU98_RS10790 (ORU98_10790) | 2217043..2217243 | - | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| ORU98_RS10795 (ORU98_10795) | 2217368..2218051 | + | 684 | WP_099821842.1 | S24 family peptidase | - |
| ORU98_RS10800 (ORU98_10800) | 2218262..2220106 | + | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| ORU98_RS10805 (ORU98_10805) | 2220136..2220540 | + | 405 | WP_146024473.1 | hypothetical protein | - |
| ORU98_RS10810 (ORU98_10810) | 2220566..2220856 | - | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| ORU98_RS10815 (ORU98_10815) | 2220853..2221167 | - | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ORU98_RS10820 (ORU98_10820) | 2221473..2221640 | - | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| ORU98_RS10825 (ORU98_10825) | 2221653..2221862 | + | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU98_RS10830 (ORU98_10830) | 2222104..2222334 | + | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU98_RS10835 (ORU98_10835) | 2222347..2222517 | + | 171 | WP_225529669.1 | hypothetical protein | - |
| ORU98_RS10840 (ORU98_10840) | 2222498..2222692 | - | 195 | WP_014391459.1 | hypothetical protein | - |
| ORU98_RS10845 (ORU98_10845) | 2223056..2223424 | + | 369 | Protein_2090 | Bro-N domain-containing protein | - |
| ORU98_RS10850 (ORU98_10850) | 2223674..2224330 | + | 657 | WP_225529682.1 | KilA-N domain-containing protein | - |
| ORU98_RS10855 (ORU98_10855) | 2224392..2224622 | - | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU98_RS10860 (ORU98_10860) | 2224770..2225069 | + | 300 | WP_078802174.1 | hypothetical protein | - |
| ORU98_RS10865 (ORU98_10865) | 2225041..2225277 | + | 237 | WP_075271355.1 | hypothetical protein | - |
| ORU98_RS10870 (ORU98_10870) | 2225290..2225577 | + | 288 | WP_014391452.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2180720..2233017 | 52297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T264886 WP_078819687.1 NZ_CP111147:c2221167-2220853 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|