Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1269300..1269901 Replicon chromosome
Accession NZ_CP111146
Organism Pasteurella multocida strain PF10

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag ORU26_RS06050 Protein ID WP_078819687.1
Coordinates 1269587..1269901 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ORU26_RS06045 Protein ID WP_078819686.1
Coordinates 1269300..1269590 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORU26_RS06010 (ORU26_06010) 1264320..1264535 - 216 WP_075271368.1 hypothetical protein -
ORU26_RS06015 (ORU26_06015) 1264532..1265215 - 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
ORU26_RS06020 (ORU26_06020) 1265276..1265737 - 462 WP_078802159.1 hypothetical protein -
ORU26_RS06025 (ORU26_06025) 1265787..1265984 - 198 WP_014390719.1 helix-turn-helix domain-containing protein -
ORU26_RS06030 (ORU26_06030) 1266108..1266785 + 678 WP_014390718.1 XRE family transcriptional regulator -
ORU26_RS06035 (ORU26_06035) 1266996..1268840 + 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
ORU26_RS06040 (ORU26_06040) 1268837..1269274 + 438 WP_078819883.1 hypothetical protein -
ORU26_RS06045 (ORU26_06045) 1269300..1269590 - 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
ORU26_RS06050 (ORU26_06050) 1269587..1269901 - 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORU26_RS06055 (ORU26_06055) 1270206..1270373 - 168 WP_005756653.1 DUF1508 domain-containing protein -
ORU26_RS06060 (ORU26_06060) 1270386..1270595 + 210 WP_005756656.1 hypothetical protein -
ORU26_RS06065 (ORU26_06065) 1270837..1271067 + 231 WP_078737821.1 hypothetical protein -
ORU26_RS06070 (ORU26_06070) 1271080..1271250 + 171 WP_155295599.1 hypothetical protein -
ORU26_RS06075 (ORU26_06075) 1271231..1271425 - 195 WP_078737822.1 hypothetical protein -
ORU26_RS06080 (ORU26_06080) 1271637..1271900 + 264 WP_071522857.1 hypothetical protein -
ORU26_RS06085 (ORU26_06085) 1272147..1272809 + 663 WP_078737830.1 KilA-N domain-containing protein -
ORU26_RS06090 (ORU26_06090) 1272871..1273101 - 231 WP_223251317.1 hypothetical protein -
ORU26_RS06095 (ORU26_06095) 1273292..1273549 + 258 WP_266199912.1 hypothetical protein -
ORU26_RS06100 (ORU26_06100) 1273521..1273757 + 237 WP_078801815.1 hypothetical protein -
ORU26_RS06105 (ORU26_06105) 1273770..1274057 + 288 WP_014391452.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1232429..1280245 47816


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264885 WP_078819687.1 NZ_CP111146:c1269901-1269587 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264885 WP_078819686.1 NZ_CP111146:c1269590-1269300 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References