Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1269300..1269901 | Replicon | chromosome |
| Accession | NZ_CP111146 | ||
| Organism | Pasteurella multocida strain PF10 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ORU26_RS06050 | Protein ID | WP_078819687.1 |
| Coordinates | 1269587..1269901 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ORU26_RS06045 | Protein ID | WP_078819686.1 |
| Coordinates | 1269300..1269590 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU26_RS06010 (ORU26_06010) | 1264320..1264535 | - | 216 | WP_075271368.1 | hypothetical protein | - |
| ORU26_RS06015 (ORU26_06015) | 1264532..1265215 | - | 684 | WP_078802160.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU26_RS06020 (ORU26_06020) | 1265276..1265737 | - | 462 | WP_078802159.1 | hypothetical protein | - |
| ORU26_RS06025 (ORU26_06025) | 1265787..1265984 | - | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| ORU26_RS06030 (ORU26_06030) | 1266108..1266785 | + | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| ORU26_RS06035 (ORU26_06035) | 1266996..1268840 | + | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| ORU26_RS06040 (ORU26_06040) | 1268837..1269274 | + | 438 | WP_078819883.1 | hypothetical protein | - |
| ORU26_RS06045 (ORU26_06045) | 1269300..1269590 | - | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| ORU26_RS06050 (ORU26_06050) | 1269587..1269901 | - | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ORU26_RS06055 (ORU26_06055) | 1270206..1270373 | - | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| ORU26_RS06060 (ORU26_06060) | 1270386..1270595 | + | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU26_RS06065 (ORU26_06065) | 1270837..1271067 | + | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU26_RS06070 (ORU26_06070) | 1271080..1271250 | + | 171 | WP_155295599.1 | hypothetical protein | - |
| ORU26_RS06075 (ORU26_06075) | 1271231..1271425 | - | 195 | WP_078737822.1 | hypothetical protein | - |
| ORU26_RS06080 (ORU26_06080) | 1271637..1271900 | + | 264 | WP_071522857.1 | hypothetical protein | - |
| ORU26_RS06085 (ORU26_06085) | 1272147..1272809 | + | 663 | WP_078737830.1 | KilA-N domain-containing protein | - |
| ORU26_RS06090 (ORU26_06090) | 1272871..1273101 | - | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU26_RS06095 (ORU26_06095) | 1273292..1273549 | + | 258 | WP_266199912.1 | hypothetical protein | - |
| ORU26_RS06100 (ORU26_06100) | 1273521..1273757 | + | 237 | WP_078801815.1 | hypothetical protein | - |
| ORU26_RS06105 (ORU26_06105) | 1273770..1274057 | + | 288 | WP_014391452.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1232429..1280245 | 47816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T264885 WP_078819687.1 NZ_CP111146:c1269901-1269587 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|