Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1435851..1436452 Replicon chromosome
Accession NZ_CP111145
Organism Pasteurella multocida strain PF9

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag ORU25_RS07270 Protein ID WP_078819687.1
Coordinates 1435851..1436165 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ORU25_RS07275 Protein ID WP_078819686.1
Coordinates 1436162..1436452 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORU25_RS07215 (ORU25_07215) 1431696..1431983 - 288 WP_014391452.1 hypothetical protein -
ORU25_RS07220 (ORU25_07220) 1431996..1432232 - 237 WP_078801815.1 hypothetical protein -
ORU25_RS07225 (ORU25_07225) 1432204..1432503 - 300 WP_014391453.1 hypothetical protein -
ORU25_RS07230 (ORU25_07230) 1432651..1432881 + 231 WP_223251317.1 hypothetical protein -
ORU25_RS07235 (ORU25_07235) 1432943..1433605 - 663 WP_078737830.1 KilA-N domain-containing protein -
ORU25_RS07240 (ORU25_07240) 1433852..1434115 - 264 WP_071522857.1 hypothetical protein -
ORU25_RS07245 (ORU25_07245) 1434327..1434521 + 195 WP_078737822.1 hypothetical protein -
ORU25_RS07250 (ORU25_07250) 1434502..1434672 - 171 WP_155295599.1 hypothetical protein -
ORU25_RS07255 (ORU25_07255) 1434685..1434915 - 231 WP_078737821.1 hypothetical protein -
ORU25_RS07260 (ORU25_07260) 1435157..1435366 - 210 WP_005756656.1 hypothetical protein -
ORU25_RS07265 (ORU25_07265) 1435379..1435546 + 168 WP_005756653.1 DUF1508 domain-containing protein -
ORU25_RS07270 (ORU25_07270) 1435851..1436165 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORU25_RS07275 (ORU25_07275) 1436162..1436452 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
ORU25_RS07280 (ORU25_07280) 1436478..1436882 - 405 WP_146024473.1 hypothetical protein -
ORU25_RS07285 (ORU25_07285) 1436912..1438756 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
ORU25_RS07290 (ORU25_07290) 1438967..1439644 - 678 WP_014390718.1 XRE family transcriptional regulator -
ORU25_RS07295 (ORU25_07295) 1439768..1439965 + 198 WP_014390719.1 helix-turn-helix domain-containing protein -
ORU25_RS07300 (ORU25_07300) 1440015..1440476 + 462 WP_078802159.1 hypothetical protein -
ORU25_RS07305 (ORU25_07305) 1440537..1441220 + 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
ORU25_RS07310 (ORU25_07310) 1441217..1441432 + 216 WP_075271368.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1425507..1467984 42477


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264884 WP_078819687.1 NZ_CP111145:1435851-1436165 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264884 WP_078819686.1 NZ_CP111145:1436162-1436452 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References