Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2259028..2259629 Replicon chromosome
Accession NZ_CP111144
Organism Pasteurella multocida strain PF7

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag ORU19_RS10980 Protein ID WP_078819687.1
Coordinates 2259028..2259342 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ORU19_RS10985 Protein ID WP_078819686.1
Coordinates 2259339..2259629 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORU19_RS10925 (ORU19_10925) 2254618..2254905 - 288 WP_014391452.1 hypothetical protein -
ORU19_RS10930 (ORU19_10930) 2254918..2255154 - 237 WP_075271355.1 hypothetical protein -
ORU19_RS10935 (ORU19_10935) 2255126..2255425 - 300 WP_078802174.1 hypothetical protein -
ORU19_RS10940 (ORU19_10940) 2255573..2255803 + 231 WP_223251317.1 hypothetical protein -
ORU19_RS10945 (ORU19_10945) 2255865..2256521 - 657 WP_225529682.1 KilA-N domain-containing protein -
ORU19_RS10950 (ORU19_10950) 2256771..2257139 - 369 Protein_2109 Bro-N domain-containing protein -
ORU19_RS10955 (ORU19_10955) 2257503..2257697 + 195 WP_014391459.1 hypothetical protein -
ORU19_RS10960 (ORU19_10960) 2257678..2257848 - 171 WP_225529669.1 hypothetical protein -
ORU19_RS10965 (ORU19_10965) 2257861..2258091 - 231 WP_078737821.1 hypothetical protein -
ORU19_RS10970 (ORU19_10970) 2258333..2258542 - 210 WP_005756656.1 hypothetical protein -
ORU19_RS10975 (ORU19_10975) 2258555..2258722 + 168 WP_005756653.1 DUF1508 domain-containing protein -
ORU19_RS10980 (ORU19_10980) 2259028..2259342 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORU19_RS10985 (ORU19_10985) 2259339..2259629 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
ORU19_RS10990 (ORU19_10990) 2259655..2260059 - 405 WP_146024473.1 hypothetical protein -
ORU19_RS10995 (ORU19_10995) 2260089..2261933 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
ORU19_RS11000 (ORU19_11000) 2262144..2262827 - 684 WP_099821842.1 S24 family peptidase -
ORU19_RS11005 (ORU19_11005) 2262952..2263152 + 201 WP_099821841.1 YdaS family helix-turn-helix protein -
ORU19_RS11010 (ORU19_11010) 2263201..2263650 + 450 WP_099821840.1 YmfL family putative regulatory protein -
ORU19_RS11015 (ORU19_11015) 2263708..2264391 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
ORU19_RS11020 (ORU19_11020) 2264388..2264603 + 216 WP_075271368.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2246548..2294708 48160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264883 WP_078819687.1 NZ_CP111144:2259028-2259342 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264883 WP_078819686.1 NZ_CP111144:2259339-2259629 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References