Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1269251..1269852 Replicon chromosome
Accession NZ_CP111143
Organism Pasteurella multocida strain PF6

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag ORU17_RS06030 Protein ID WP_078819687.1
Coordinates 1269538..1269852 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ORU17_RS06025 Protein ID WP_078819686.1
Coordinates 1269251..1269541 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORU17_RS05990 (ORU17_05990) 1264271..1264486 - 216 WP_075271368.1 hypothetical protein -
ORU17_RS05995 (ORU17_05995) 1264483..1265166 - 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
ORU17_RS06000 (ORU17_06000) 1265227..1265688 - 462 WP_078802159.1 hypothetical protein -
ORU17_RS06005 (ORU17_06005) 1265738..1265935 - 198 WP_014390719.1 helix-turn-helix domain-containing protein -
ORU17_RS06010 (ORU17_06010) 1266059..1266736 + 678 WP_014390718.1 XRE family transcriptional regulator -
ORU17_RS06015 (ORU17_06015) 1266947..1268791 + 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
ORU17_RS06020 (ORU17_06020) 1268821..1269225 + 405 WP_146024473.1 hypothetical protein -
ORU17_RS06025 (ORU17_06025) 1269251..1269541 - 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
ORU17_RS06030 (ORU17_06030) 1269538..1269852 - 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORU17_RS06035 (ORU17_06035) 1270157..1270324 - 168 WP_005756653.1 DUF1508 domain-containing protein -
ORU17_RS06040 (ORU17_06040) 1270337..1270546 + 210 WP_005756656.1 hypothetical protein -
ORU17_RS06045 (ORU17_06045) 1270788..1271018 + 231 WP_078737821.1 hypothetical protein -
ORU17_RS06050 (ORU17_06050) 1271031..1271201 + 171 WP_155295599.1 hypothetical protein -
ORU17_RS06055 (ORU17_06055) 1271182..1271376 - 195 WP_078737822.1 hypothetical protein -
ORU17_RS06060 (ORU17_06060) 1271588..1271851 + 264 WP_071522857.1 hypothetical protein -
ORU17_RS06065 (ORU17_06065) 1272098..1272760 + 663 WP_078737830.1 KilA-N domain-containing protein -
ORU17_RS06070 (ORU17_06070) 1272822..1273052 - 231 WP_223251317.1 hypothetical protein -
ORU17_RS06075 (ORU17_06075) 1273200..1273499 + 300 WP_014391453.1 hypothetical protein -
ORU17_RS06080 (ORU17_06080) 1273471..1273707 + 237 WP_078801815.1 hypothetical protein -
ORU17_RS06085 (ORU17_06085) 1273720..1274007 + 288 WP_014391452.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1232380..1280198 47818


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264882 WP_078819687.1 NZ_CP111143:c1269852-1269538 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264882 WP_078819686.1 NZ_CP111143:c1269541-1269251 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References