264881

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2259031..2259632 Replicon chromosome
Accession NZ_CP111142
Organism Pasteurella multocida strain PF5

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag ORU08_RS10990 Protein ID WP_078819687.1
Coordinates 2259031..2259345 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ORU08_RS10995 Protein ID WP_078819686.1
Coordinates 2259342..2259632 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORU08_RS10935 (ORU08_10935) 2254621..2254908 - 288 WP_014391452.1 hypothetical protein -
ORU08_RS10940 (ORU08_10940) 2254921..2255157 - 237 WP_075271355.1 hypothetical protein -
ORU08_RS10945 (ORU08_10945) 2255129..2255428 - 300 WP_078802174.1 hypothetical protein -
ORU08_RS10950 (ORU08_10950) 2255576..2255806 + 231 WP_223251317.1 hypothetical protein -
ORU08_RS10955 (ORU08_10955) 2255868..2256524 - 657 WP_225529682.1 KilA-N domain-containing protein -
ORU08_RS10960 (ORU08_10960) 2256774..2257142 - 369 Protein_2111 Bro-N domain-containing protein -
ORU08_RS10965 (ORU08_10965) 2257506..2257700 + 195 WP_014391459.1 hypothetical protein -
ORU08_RS10970 (ORU08_10970) 2257681..2257851 - 171 WP_225529669.1 hypothetical protein -
ORU08_RS10975 (ORU08_10975) 2257864..2258094 - 231 WP_078737821.1 hypothetical protein -
ORU08_RS10980 (ORU08_10980) 2258336..2258545 - 210 WP_005756656.1 hypothetical protein -
ORU08_RS10985 (ORU08_10985) 2258558..2258725 + 168 WP_005756653.1 DUF1508 domain-containing protein -
ORU08_RS10990 (ORU08_10990) 2259031..2259345 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORU08_RS10995 (ORU08_10995) 2259342..2259632 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
ORU08_RS11000 (ORU08_11000) 2259658..2260062 - 405 WP_146024473.1 hypothetical protein -
ORU08_RS11005 (ORU08_11005) 2260092..2261936 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
ORU08_RS11010 (ORU08_11010) 2262147..2262830 - 684 WP_099821842.1 S24 family peptidase -
ORU08_RS11015 (ORU08_11015) 2262955..2263155 + 201 WP_099821841.1 YdaS family helix-turn-helix protein -
ORU08_RS11020 (ORU08_11020) 2263204..2263653 + 450 WP_099821840.1 YmfL family putative regulatory protein -
ORU08_RS11025 (ORU08_11025) 2263711..2264394 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
ORU08_RS11030 (ORU08_11030) 2264391..2264606 + 216 WP_075271368.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2246551..2294711 48160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264881 WP_078819687.1 NZ_CP111142:2259031-2259345 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264881 WP_078819686.1 NZ_CP111142:2259342-2259632 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References