Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT_toxin-BrnA |
Location | 2975566..2976103 | Replicon | chromosome |
Accession | NZ_CP111140 | ||
Organism | Burkholderia pseudomallei strain MSHR1046 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A2K9CXB8 |
Locus tag | OSB54_RS12425 | Protein ID | WP_004557717.1 |
Coordinates | 2975834..2976103 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | Q63NA3 |
Locus tag | OSB54_RS12420 | Protein ID | WP_004525420.1 |
Coordinates | 2975566..2975850 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSB54_RS12395 (OSB54_12395) | 2970674..2972044 | - | 1371 | WP_004525424.1 | cytochrome c peroxidase | - |
OSB54_RS12400 (OSB54_12400) | 2972095..2973555 | - | 1461 | WP_004525423.1 | metallophosphoesterase | - |
OSB54_RS12405 (OSB54_12405) | 2973802..2973918 | + | 117 | Protein_2470 | IS3 family transposase | - |
OSB54_RS12410 (OSB54_12410) | 2974145..2974537 | - | 393 | Protein_2471 | IS110 family transposase | - |
OSB54_RS12415 (OSB54_12415) | 2974536..2974919 | - | 384 | Protein_2472 | integrase core domain-containing protein | - |
OSB54_RS12420 (OSB54_12420) | 2975566..2975850 | - | 285 | WP_004525420.1 | BrnA antitoxin family protein | Antitoxin |
OSB54_RS12425 (OSB54_12425) | 2975834..2976103 | - | 270 | WP_004557717.1 | BrnT family toxin | Toxin |
OSB54_RS12430 (OSB54_12430) | 2976656..2976931 | + | 276 | WP_004525419.1 | hypothetical protein | - |
OSB54_RS12435 (OSB54_12435) | 2976941..2977072 | + | 132 | WP_009923452.1 | bacteriophage protein Gp48 | - |
OSB54_RS12440 (OSB54_12440) | 2977211..2977429 | + | 219 | WP_004557714.1 | hypothetical protein | - |
OSB54_RS12445 (OSB54_12445) | 2977477..2977695 | + | 219 | WP_004552392.1 | hypothetical protein | - |
OSB54_RS12450 (OSB54_12450) | 2977926..2978507 | - | 582 | WP_004542548.1 | hypothetical protein | - |
OSB54_RS12455 (OSB54_12455) | 2978763..2978912 | + | 150 | WP_004542626.1 | bacteriophage protein Gp44 | - |
OSB54_RS12460 (OSB54_12460) | 2978948..2979529 | + | 582 | Protein_2481 | SPFH domain-containing protein | - |
OSB54_RS12465 (OSB54_12465) | 2979680..2980108 | + | 429 | Protein_2482 | integrase core domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2972095..2982419 | 10324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10183.54 Da Isoelectric Point: 5.6831
>T264879 WP_004557717.1 NZ_CP111140:c2976103-2975834 [Burkholderia pseudomallei]
MDITFDPTKNETNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDLMHIISMRKANKR
EVKSYVEQA
MDITFDPTKNETNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDLMHIISMRKANKR
EVKSYVEQA
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K9CXB8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F6L9S8 |