Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 3923473..3924128 | Replicon | chromosome |
Accession | NZ_CP111139 | ||
Organism | Burkholderia pseudomallei strain MSHR1713 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OSB35_RS30390 | Protein ID | WP_004521942.1 |
Coordinates | 3923832..3924128 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q63YL3 |
Locus tag | OSB35_RS30385 | Protein ID | WP_004202809.1 |
Coordinates | 3923473..3923829 (-) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSB35_RS30355 (OSB35_30355) | 3919599..3920357 | + | 759 | WP_004521940.1 | cytochrome c1 | - |
OSB35_RS30360 (OSB35_30360) | 3920450..3921061 | + | 612 | WP_004185176.1 | glutathione S-transferase N-terminal domain-containing protein | - |
OSB35_RS30365 (OSB35_30365) | 3921131..3921658 | + | 528 | WP_004521941.1 | ClpXP protease specificity-enhancing factor | - |
OSB35_RS30375 (OSB35_30375) | 3921994..3922377 | + | 384 | WP_044584020.1 | terminase | - |
OSB35_RS30380 (OSB35_30380) | 3922374..3923429 | + | 1056 | WP_004557286.1 | phage portal protein | - |
OSB35_RS30385 (OSB35_30385) | 3923473..3923829 | - | 357 | WP_004202809.1 | putative addiction module antidote protein | Antitoxin |
OSB35_RS30390 (OSB35_30390) | 3923832..3924128 | - | 297 | WP_004521942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OSB35_RS30395 (OSB35_30395) | 3924796..3926052 | + | 1257 | WP_004552667.1 | AAA family ATPase | - |
OSB35_RS30400 (OSB35_30400) | 3926097..3926672 | + | 576 | WP_198014201.1 | DUF4276 family protein | - |
OSB35_RS30405 (OSB35_30405) | 3927426..3927770 | + | 345 | WP_004535737.1 | hypothetical protein | - |
OSB35_RS30410 (OSB35_30410) | 3927763..3928174 | + | 412 | Protein_3493 | phage tail protein I | - |
OSB35_RS30415 (OSB35_30415) | 3928213..3928674 | + | 462 | WP_232290550.1 | DNA methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3922063..3930130 | 8067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10902.68 Da Isoelectric Point: 9.9369
>T264876 WP_004521942.1 NZ_CP111139:c3924128-3923832 [Burkholderia pseudomallei]
MFKVLTTPQFDKWLDGLRDPVGSAAINLRIERAKLGNLGQWRAVGDGVNEMKIDVGPGYRAYFVRRGKIIVVVLCGGDKS
TQKKDIKLAKQIADELED
MFKVLTTPQFDKWLDGLRDPVGSAAINLRIERAKLGNLGQWRAVGDGVNEMKIDVGPGYRAYFVRRGKIIVVVLCGGDKS
TQKKDIKLAKQIADELED
Download Length: 297 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 12585.41 Da Isoelectric Point: 9.9470
>AT264876 WP_004202809.1 NZ_CP111139:c3923829-3923473 [Burkholderia pseudomallei]
MKISELAEFDGSKYLKDEETIRHYLAQAFEDGNPRLIQAALGNVAKARGMTALARESGVKREALYRALSEGGNAEFATIM
KVVGALGLHLTVAPAEPAPVPAPATTRARSRVRTAAHA
MKISELAEFDGSKYLKDEETIRHYLAQAFEDGNPRLIQAALGNVAKARGMTALARESGVKREALYRALSEGGNAEFATIM
KVVGALGLHLTVAPAEPAPVPAPATTRARSRVRTAAHA
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|