Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT_toxin-BrnA |
| Location | 1799450..1799987 | Replicon | chromosome |
| Accession | NZ_CP111137 | ||
| Organism | Burkholderia pseudomallei strain MSHR7744 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A2K9CXB8 |
| Locus tag | OSB53_RS25695 | Protein ID | WP_004557717.1 |
| Coordinates | 1799718..1799987 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | Q63NA3 |
| Locus tag | OSB53_RS25690 | Protein ID | WP_004525420.1 |
| Coordinates | 1799450..1799734 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSB53_RS25665 (OSB53_25665) | 1794558..1795928 | - | 1371 | WP_004525424.1 | cytochrome c peroxidase | - |
| OSB53_RS25670 (OSB53_25670) | 1795979..1797439 | - | 1461 | WP_004525423.1 | metallophosphoesterase | - |
| OSB53_RS25675 (OSB53_25675) | 1797686..1797802 | + | 117 | Protein_1449 | IS3 family transposase | - |
| OSB53_RS25680 (OSB53_25680) | 1798029..1798421 | - | 393 | Protein_1450 | IS110 family transposase | - |
| OSB53_RS25685 (OSB53_25685) | 1798420..1798803 | - | 384 | Protein_1451 | integrase core domain-containing protein | - |
| OSB53_RS25690 (OSB53_25690) | 1799450..1799734 | - | 285 | WP_004525420.1 | BrnA antitoxin family protein | Antitoxin |
| OSB53_RS25695 (OSB53_25695) | 1799718..1799987 | - | 270 | WP_004557717.1 | BrnT family toxin | Toxin |
| OSB53_RS25700 (OSB53_25700) | 1800540..1800815 | + | 276 | WP_004525419.1 | hypothetical protein | - |
| OSB53_RS25705 (OSB53_25705) | 1800825..1800956 | + | 132 | WP_009923452.1 | bacteriophage protein Gp48 | - |
| OSB53_RS25710 (OSB53_25710) | 1801092..1801313 | + | 222 | WP_004525418.1 | hypothetical protein | - |
| OSB53_RS25715 (OSB53_25715) | 1801361..1801579 | + | 219 | WP_004552392.1 | hypothetical protein | - |
| OSB53_RS25720 (OSB53_25720) | 1801810..1802391 | - | 582 | WP_004542548.1 | hypothetical protein | - |
| OSB53_RS25725 (OSB53_25725) | 1802647..1802796 | + | 150 | WP_004542626.1 | bacteriophage protein Gp44 | - |
| OSB53_RS25730 (OSB53_25730) | 1802832..1803365 | + | 534 | Protein_1460 | SPFH domain-containing protein | - |
| OSB53_RS25735 (OSB53_25735) | 1803564..1803992 | + | 429 | Protein_1461 | integrase core domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1795979..1806303 | 10324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10183.54 Da Isoelectric Point: 5.6831
>T264872 WP_004557717.1 NZ_CP111137:c1799987-1799718 [Burkholderia pseudomallei]
MDITFDPTKNETNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDLMHIISMRKANKR
EVKSYVEQA
MDITFDPTKNETNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDLMHIISMRKANKR
EVKSYVEQA
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K9CXB8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F6L9S8 |