Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 4373256..4373803 | Replicon | chromosome |
Accession | NZ_CP111121 | ||
Organism | Chryseobacterium sp. MMS21-Ot14 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | ODZ84_RS20020 | Protein ID | WP_266174170.1 |
Coordinates | 4373256..4373555 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | ODZ84_RS20025 | Protein ID | WP_266174171.1 |
Coordinates | 4373555..4373803 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODZ84_RS20000 (ODZ84_20000) | 4368828..4369811 | - | 984 | WP_266174165.1 | GTPase ObgE | - |
ODZ84_RS20005 (ODZ84_20005) | 4369892..4370470 | - | 579 | WP_266174167.1 | adenylate kinase | - |
ODZ84_RS20010 (ODZ84_20010) | 4370621..4371175 | - | 555 | WP_266174168.1 | hypoxanthine phosphoribosyltransferase | - |
ODZ84_RS20015 (ODZ84_20015) | 4371537..4373126 | + | 1590 | WP_266174169.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
ODZ84_RS20020 (ODZ84_20020) | 4373256..4373555 | - | 300 | WP_266174170.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ODZ84_RS20025 (ODZ84_20025) | 4373555..4373803 | - | 249 | WP_266174171.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
ODZ84_RS20030 (ODZ84_20030) | 4373865..4374728 | - | 864 | WP_266174172.1 | DUF4238 domain-containing protein | - |
ODZ84_RS20035 (ODZ84_20035) | 4374889..4376175 | + | 1287 | WP_266174173.1 | adenylosuccinate synthase | - |
ODZ84_RS20040 (ODZ84_20040) | 4376757..4377602 | + | 846 | WP_266174174.1 | energy transducer TonB | - |
ODZ84_RS20045 (ODZ84_20045) | 4377766..4378539 | + | 774 | WP_266174175.1 | ParA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 12230.99 Da Isoelectric Point: 7.3121
>T264868 WP_266174170.1 NZ_CP111121:c4373555-4373256 [Chryseobacterium sp. MMS21-Ot14]
MKYRISKEASNDLEKIWLYTFEVWSKEQADHYFDLLMDEIEYLSENPKSGKDYNEIRKGYLRSRVKSHFIFYRINLKYKE
IEIIRILHQKMDISSRLDE
MKYRISKEASNDLEKIWLYTFEVWSKEQADHYFDLLMDEIEYLSENPKSGKDYNEIRKGYLRSRVKSHFIFYRINLKYKE
IEIIRILHQKMDISSRLDE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|