Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4871555..4872131 | Replicon | chromosome |
Accession | NZ_CP111115 | ||
Organism | Raoultella sp. DY2415 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A808YBH6 |
Locus tag | OQV00_RS23125 | Protein ID | WP_032716505.1 |
Coordinates | 4871844..4872131 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | OQV00_RS23120 | Protein ID | WP_064357555.1 |
Coordinates | 4871555..4871857 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQV00_RS23105 | 4867494..4867829 | + | 336 | WP_100663658.1 | endoribonuclease SymE | - |
OQV00_RS23110 | 4868060..4870132 | + | 2073 | WP_100663657.1 | AAA family ATPase | - |
OQV00_RS23115 | 4870132..4871454 | + | 1323 | WP_069476271.1 | restriction endonuclease | - |
OQV00_RS23120 | 4871555..4871857 | - | 303 | WP_064357555.1 | BrnA antitoxin family protein | Antitoxin |
OQV00_RS23125 | 4871844..4872131 | - | 288 | WP_032716505.1 | BrnT family toxin | Toxin |
OQV00_RS23130 | 4872248..4872667 | - | 420 | WP_004857515.1 | FosA family fosfomycin resistance glutathione transferase | - |
OQV00_RS23135 | 4872661..4873569 | - | 909 | WP_004857513.1 | LysR family transcriptional regulator | - |
OQV00_RS23140 | 4873657..4874439 | + | 783 | WP_048024655.1 | NAD(P)H-dependent oxidoreductase | - |
OQV00_RS23145 | 4874587..4875165 | + | 579 | WP_004857495.1 | TetR/AcrR family transcriptional regulator | - |
OQV00_RS23150 | 4875309..4876121 | + | 813 | WP_004857492.1 | winged helix-turn-helix domain-containing protein | - |
OQV00_RS23155 | 4876118..4876636 | + | 519 | WP_015585229.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11131.57 Da Isoelectric Point: 7.5235
>T264867 WP_032716505.1 NZ_CP111115:c4872131-4871844 [Raoultella sp. DY2415]
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRHDRYENGEYRWQTIGLVHGVIVVLVAHSIRFESGTEVIRIIS
ARKADKKERSRYEHG
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRHDRYENGEYRWQTIGLVHGVIVVLVAHSIRFESGTEVIRIIS
ARKADKKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|