Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4293417..4294036 Replicon chromosome
Accession NZ_CP111115
Organism Raoultella sp. DY2415

Toxin (Protein)


Gene name Hha Uniprot ID A0A514EV16
Locus tag OQV00_RS20430 Protein ID WP_004858783.1
Coordinates 4293818..4294036 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A514EV88
Locus tag OQV00_RS20425 Protein ID WP_004858785.1
Coordinates 4293417..4293791 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQV00_RS20415 4288527..4289720 + 1194 WP_004858789.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OQV00_RS20420 4289743..4292889 + 3147 WP_004858787.1 multidrug efflux RND transporter permease subunit AcrB -
OQV00_RS20425 4293417..4293791 + 375 WP_004858785.1 Hha toxicity modulator TomB Antitoxin
OQV00_RS20430 4293818..4294036 + 219 WP_004858783.1 HHA domain-containing protein Toxin
OQV00_RS20435 4294188..4294754 + 567 WP_004858781.1 maltose O-acetyltransferase -
OQV00_RS20440 4294726..4294860 - 135 WP_223306663.1 hypothetical protein -
OQV00_RS20445 4294854..4295324 + 471 WP_004858780.1 YlaC family protein -
OQV00_RS20450 4295299..4296750 - 1452 WP_104896844.1 PLP-dependent aminotransferase family protein -
OQV00_RS20455 4296855..4297565 + 711 WP_015585015.1 GNAT family protein -
OQV00_RS20460 4297562..4297702 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
OQV00_RS20465 4297705..4297965 - 261 WP_004858777.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8570.90 Da        Isoelectric Point: 7.9907

>T264866 WP_004858783.1 NZ_CP111115:4293818-4294036 [Raoultella sp. DY2415]
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14411.19 Da        Isoelectric Point: 4.8989

>AT264866 WP_004858785.1 NZ_CP111115:4293417-4293791 [Raoultella sp. DY2415]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A514EV16

Antitoxin

Source ID Structure
AlphaFold DB A0A514EV88

References