Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4293417..4294036 | Replicon | chromosome |
| Accession | NZ_CP111115 | ||
| Organism | Raoultella sp. DY2415 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A514EV16 |
| Locus tag | OQV00_RS20430 | Protein ID | WP_004858783.1 |
| Coordinates | 4293818..4294036 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A514EV88 |
| Locus tag | OQV00_RS20425 | Protein ID | WP_004858785.1 |
| Coordinates | 4293417..4293791 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQV00_RS20415 | 4288527..4289720 | + | 1194 | WP_004858789.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OQV00_RS20420 | 4289743..4292889 | + | 3147 | WP_004858787.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OQV00_RS20425 | 4293417..4293791 | + | 375 | WP_004858785.1 | Hha toxicity modulator TomB | Antitoxin |
| OQV00_RS20430 | 4293818..4294036 | + | 219 | WP_004858783.1 | HHA domain-containing protein | Toxin |
| OQV00_RS20435 | 4294188..4294754 | + | 567 | WP_004858781.1 | maltose O-acetyltransferase | - |
| OQV00_RS20440 | 4294726..4294860 | - | 135 | WP_223306663.1 | hypothetical protein | - |
| OQV00_RS20445 | 4294854..4295324 | + | 471 | WP_004858780.1 | YlaC family protein | - |
| OQV00_RS20450 | 4295299..4296750 | - | 1452 | WP_104896844.1 | PLP-dependent aminotransferase family protein | - |
| OQV00_RS20455 | 4296855..4297565 | + | 711 | WP_015585015.1 | GNAT family protein | - |
| OQV00_RS20460 | 4297562..4297702 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| OQV00_RS20465 | 4297705..4297965 | - | 261 | WP_004858777.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8570.90 Da Isoelectric Point: 7.9907
>T264866 WP_004858783.1 NZ_CP111115:4293818-4294036 [Raoultella sp. DY2415]
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14411.19 Da Isoelectric Point: 4.8989
>AT264866 WP_004858785.1 NZ_CP111115:4293417-4293791 [Raoultella sp. DY2415]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A514EV16 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A514EV88 |