Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 880688..881345 | Replicon | chromosome |
| Accession | NZ_CP111115 | ||
| Organism | Raoultella sp. DY2415 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A808XTM6 |
| Locus tag | OQV00_RS04230 | Protein ID | WP_004867355.1 |
| Coordinates | 880935..881345 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A514ELX1 |
| Locus tag | OQV00_RS04225 | Protein ID | WP_004867358.1 |
| Coordinates | 880688..880954 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQV00_RS04200 | 875823..877256 | - | 1434 | WP_004867372.1 | 6-phospho-beta-glucosidase | - |
| OQV00_RS04205 | 877376..878104 | - | 729 | WP_004867368.1 | MurR/RpiR family transcriptional regulator | - |
| OQV00_RS04210 | 878154..878465 | + | 312 | WP_004867365.1 | N(4)-acetylcytidine aminohydrolase | - |
| OQV00_RS04215 | 878627..879286 | + | 660 | WP_004867362.1 | hemolysin III family protein | - |
| OQV00_RS04220 | 879408..880391 | - | 984 | WP_015585783.1 | tRNA-modifying protein YgfZ | - |
| OQV00_RS04225 | 880688..880954 | + | 267 | WP_004867358.1 | FAD assembly factor SdhE | Antitoxin |
| OQV00_RS04230 | 880935..881345 | + | 411 | WP_004867355.1 | protein YgfX | Toxin |
| OQV00_RS04235 | 881353..881874 | - | 522 | WP_004867353.1 | flavodoxin FldB | - |
| OQV00_RS04240 | 882052..882948 | + | 897 | WP_032718225.1 | site-specific tyrosine recombinase XerD | - |
| OQV00_RS04245 | 882971..883684 | + | 714 | WP_004867349.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OQV00_RS04250 | 883690..885423 | + | 1734 | WP_015585785.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16226.16 Da Isoelectric Point: 11.3349
>T264859 WP_004867355.1 NZ_CP111115:880935-881345 [Raoultella sp. DY2415]
VVLWQSDLRISWRSQWFSLLLHGIVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWIAADSMDAKEWRDLRRLVLQKPAQE
VVLWQSDLRISWRSQWFSLLLHGIVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWIAADSMDAKEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808XTM6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A514ELX1 |