Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 67102..67649 Replicon chromosome
Accession NZ_CP111115
Organism Raoultella sp. DY2415

Toxin (Protein)


Gene name ccdB Uniprot ID A0A808XUV0
Locus tag OQV00_RS00315 Protein ID WP_048025274.1
Coordinates 67102..67410 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A808XYT1
Locus tag OQV00_RS00320 Protein ID WP_004869059.1
Coordinates 67413..67649 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQV00_RS00285 62281..62583 - 303 WP_015585486.1 PTS lactose/cellobiose transporter subunit IIA -
OQV00_RS00290 62718..64043 - 1326 WP_266279656.1 PTS transporter subunit EIIC -
OQV00_RS00295 64055..64369 - 315 WP_004869063.1 PTS sugar transporter subunit IIB -
OQV00_RS00300 64664..65605 + 942 WP_015585487.1 LacI family DNA-binding transcriptional regulator -
OQV00_RS00305 65700..65975 - 276 WP_162098187.1 YicS family protein -
OQV00_RS00310 66084..66986 - 903 WP_015585496.1 EamA family transporter -
OQV00_RS00315 67102..67410 - 309 WP_048025274.1 CcdB family protein Toxin
OQV00_RS00320 67413..67649 - 237 WP_004869059.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OQV00_RS00325 67755..69188 - 1434 WP_266279658.1 PTS N-acetylmuramic acid transporter subunit IIBC -
OQV00_RS00330 69213..70115 - 903 WP_064359684.1 N-acetylmuramic acid 6-phosphate etherase -
OQV00_RS00335 70280..71443 - 1164 WP_004869055.1 multidrug effflux MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(8-78)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11778.62 Da        Isoelectric Point: 6.7156

>T264858 WP_048025274.1 NZ_CP111115:c67410-67102 [Raoultella sp. DY2415]
IQYYVYKNTGRITVYPYLLDVQSDIIGMRNTRVVIPLFPLRNYKGPRADRLTPVVTVEGEEYVVMTHELASIPQRVLGEE
VCHLNHQREVVKASIDFLFDGI

Download         Length: 309 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8898.08 Da        Isoelectric Point: 5.6579

>AT264858 WP_004869059.1 NZ_CP111115:c67649-67413 [Raoultella sp. DY2415]
MPAVKHNKQNVSVTLDPILVKQAREIGINLSQTLTSALKSEIHSIEMARWQKENARAIDYLNDLTEENGLLSDEYRTF

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A808XUV0

Antitoxin

Source ID Structure
AlphaFold DB A0A808XYT1

References