Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 3432856..3433375 | Replicon | chromosome |
| Accession | NZ_CP111114 | ||
| Organism | Pseudomonas koreensis strain FP1691 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OPS05_RS15260 | Protein ID | WP_098964185.1 |
| Coordinates | 3432856..3433137 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2R7MVA5 |
| Locus tag | OPS05_RS15265 | Protein ID | WP_003225462.1 |
| Coordinates | 3433127..3433375 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPS05_RS15230 (OPS05_15230) | 3428145..3428909 | - | 765 | WP_027612656.1 | IclR family transcriptional regulator | - |
| OPS05_RS15235 (OPS05_15235) | 3429121..3429510 | - | 390 | WP_007912330.1 | RidA family protein | - |
| OPS05_RS15240 (OPS05_15240) | 3429541..3430338 | - | 798 | WP_097087296.1 | amino acid ABC transporter ATP-binding protein | - |
| OPS05_RS15245 (OPS05_15245) | 3430335..3430997 | - | 663 | WP_134786515.1 | amino acid ABC transporter permease | - |
| OPS05_RS15250 (OPS05_15250) | 3431007..3431669 | - | 663 | WP_134786516.1 | amino acid ABC transporter permease | - |
| OPS05_RS15255 (OPS05_15255) | 3431721..3432569 | - | 849 | WP_098964184.1 | transporter substrate-binding domain-containing protein | - |
| OPS05_RS15260 (OPS05_15260) | 3432856..3433137 | - | 282 | WP_098964185.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OPS05_RS15265 (OPS05_15265) | 3433127..3433375 | - | 249 | WP_003225462.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OPS05_RS15270 (OPS05_15270) | 3433652..3434080 | + | 429 | WP_134786517.1 | thioredoxin family protein | - |
| OPS05_RS15275 (OPS05_15275) | 3434247..3435806 | - | 1560 | WP_134786518.1 | TerC family protein | - |
| OPS05_RS15280 (OPS05_15280) | 3436222..3437868 | - | 1647 | WP_134786519.1 | phospholipase D-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10911.69 Da Isoelectric Point: 10.6783
>T264856 WP_098964185.1 NZ_CP111114:c3433137-3432856 [Pseudomonas koreensis]
MTYELEFSEKAWREWRKLDSALQDQFKKKLSTRLVNPHVPADRLRGLGNAYKIKLRSAGYRLVYRVKNEVLVVTVIAVGR
RERGEVYDKAACR
MTYELEFSEKAWREWRKLDSALQDQFKKKLSTRLVNPHVPADRLRGLGNAYKIKLRSAGYRLVYRVKNEVLVVTVIAVGR
RERGEVYDKAACR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|