Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1838878..1839494 | Replicon | chromosome |
| Accession | NZ_CP111114 | ||
| Organism | Pseudomonas koreensis strain FP1691 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OPS05_RS08270 | Protein ID | WP_134785765.1 |
| Coordinates | 1838878..1839090 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | W6W5D4 |
| Locus tag | OPS05_RS08275 | Protein ID | WP_007961664.1 |
| Coordinates | 1839090..1839494 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPS05_RS08245 (OPS05_08245) | 1834982..1835518 | + | 537 | WP_041072930.1 | DsbE family thiol:disulfide interchange protein | - |
| OPS05_RS08250 (OPS05_08250) | 1835515..1835985 | + | 471 | WP_003222948.1 | cytochrome c-type biogenesis protein CcmH | - |
| OPS05_RS08255 (OPS05_08255) | 1835982..1837184 | + | 1203 | WP_134785763.1 | c-type cytochrome biogenesis protein CcmI | - |
| OPS05_RS08260 (OPS05_08260) | 1837212..1837616 | + | 405 | WP_134785764.1 | hypothetical protein | - |
| OPS05_RS08265 (OPS05_08265) | 1837723..1838610 | - | 888 | WP_266276287.1 | LysR family transcriptional regulator | - |
| OPS05_RS08270 (OPS05_08270) | 1838878..1839090 | + | 213 | WP_134785765.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OPS05_RS08275 (OPS05_08275) | 1839090..1839494 | + | 405 | WP_007961664.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OPS05_RS08280 (OPS05_08280) | 1839553..1840740 | - | 1188 | WP_096796242.1 | MFS transporter | - |
| OPS05_RS08285 (OPS05_08285) | 1840984..1841604 | + | 621 | WP_134785766.1 | DUF5666 domain-containing protein | - |
| OPS05_RS08290 (OPS05_08290) | 1841884..1843161 | + | 1278 | WP_134785767.1 | hypothetical protein | - |
| OPS05_RS08295 (OPS05_08295) | 1843148..1844095 | + | 948 | WP_127646222.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 8025.26 Da Isoelectric Point: 10.3701
>T264853 WP_134785765.1 NZ_CP111114:1838878-1839090 [Pseudomonas koreensis]
VQSRLLIKELEEAGWTLDRVIGSHHIFTHRYNPYTIPVPHPKKDLPLGTVKSIRRRAGLYHPPASYKGDP
VQSRLLIKELEEAGWTLDRVIGSHHIFTHRYNPYTIPVPHPKKDLPLGTVKSIRRRAGLYHPPASYKGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14836.80 Da Isoelectric Point: 4.2870
>AT264853 WP_007961664.1 NZ_CP111114:1839090-1839494 [Pseudomonas koreensis]
MQYPICIEWGDDNTAIGIQIPDIPGAVTAGDTFEDAYNAAVEVAHLMLQEMAADGESIPMPTSAAAHRNNPEFADMGWGM
LELDISPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDDNTAIGIQIPDIPGAVTAGDTFEDAYNAAVEVAHLMLQEMAADGESIPMPTSAAAHRNNPEFADMGWGM
LELDISPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|