Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 354074..354685 | Replicon | chromosome |
| Accession | NZ_CP111114 | ||
| Organism | Pseudomonas koreensis strain FP1691 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OPS05_RS01545 | Protein ID | WP_256662070.1 |
| Coordinates | 354074..354229 (+) | Length | 52 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OPS05_RS01550 | Protein ID | WP_134785205.1 |
| Coordinates | 354260..354685 (+) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPS05_RS01510 (OPS05_01510) | 349196..349573 | + | 378 | WP_134787544.1 | GNAT family N-acetyltransferase | - |
| OPS05_RS01515 (OPS05_01515) | 349570..350286 | + | 717 | WP_003220701.1 | AzlC family ABC transporter permease | - |
| OPS05_RS01520 (OPS05_01520) | 350265..350582 | + | 318 | WP_003220702.1 | AzlD domain-containing protein | - |
| OPS05_RS01525 (OPS05_01525) | 350499..351425 | - | 927 | WP_007961685.1 | LysR family transcriptional regulator | - |
| OPS05_RS01530 (OPS05_01530) | 352163..352573 | + | 411 | WP_134785202.1 | MbcA/ParS/Xre antitoxin family protein | - |
| OPS05_RS01535 (OPS05_01535) | 352570..353250 | + | 681 | WP_134785203.1 | RES family NAD+ phosphorylase | - |
| OPS05_RS01540 (OPS05_01540) | 353302..353577 | - | 276 | WP_134785204.1 | DUF3077 domain-containing protein | - |
| OPS05_RS01545 (OPS05_01545) | 354074..354229 | + | 156 | WP_256662070.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OPS05_RS01550 (OPS05_01550) | 354260..354685 | + | 426 | WP_134785205.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OPS05_RS01555 (OPS05_01555) | 354734..354880 | + | 147 | Protein_303 | transcriptional regulator | - |
| OPS05_RS01560 (OPS05_01560) | 354985..355851 | - | 867 | WP_134785206.1 | hypothetical protein | - |
| OPS05_RS01570 (OPS05_01570) | 356463..357698 | - | 1236 | WP_134785207.1 | methyltransferase | - |
| OPS05_RS01575 (OPS05_01575) | 357679..358368 | - | 690 | WP_007961692.1 | ABC transporter permease | - |
| OPS05_RS01580 (OPS05_01580) | 358365..359060 | - | 696 | WP_007961693.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5486.35 Da Isoelectric Point: 10.5756
>T264852 WP_256662070.1 NZ_CP111114:354074-354229 [Pseudomonas koreensis]
MKAQGVEFQTGKGGHFKVSLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
MKAQGVEFQTGKGGHFKVSLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
Download Length: 156 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15578.82 Da Isoelectric Point: 4.9736
>AT264852 WP_134785205.1 NZ_CP111114:354260-354685 [Pseudomonas koreensis]
MFEYALEVHEEPGSVWLTCAEIPEMHAVGDTLEQALDTAIDAIETALSIYVDDRRLIPTGQAGEQASGVVLRLPALTAAK
VALWNTLLESGLSKAELARRLRVQRPQVDRLVDFLHHSKIENVERALQQLGRRISLSVQAA
MFEYALEVHEEPGSVWLTCAEIPEMHAVGDTLEQALDTAIDAIETALSIYVDDRRLIPTGQAGEQASGVVLRLPALTAAK
VALWNTLLESGLSKAELARRLRVQRPQVDRLVDFLHHSKIENVERALQQLGRRISLSVQAA
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|