Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2061426..2061896 Replicon chromosome
Accession NZ_CP111111
Organism Staphylococcus epidermidis strain KCTC 13172

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag ORT68_RS09865 Protein ID WP_001829569.1
Coordinates 2061708..2061896 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag ORT68_RS09860 Protein ID WP_002438963.1
Coordinates 2061426..2061683 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORT68_RS09820 (ORT68_09820) 2056790..2057506 - 717 WP_266196249.1 type I 3-dehydroquinate dehydratase -
ORT68_RS09825 (ORT68_09825) 2057667..2058089 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
ORT68_RS09830 (ORT68_09830) 2058273..2058410 - 138 WP_032604695.1 hypothetical protein -
ORT68_RS09835 (ORT68_09835) 2058440..2058627 - 188 Protein_1905 hypothetical protein -
ORT68_RS09840 (ORT68_09840) 2059014..2059514 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
ORT68_RS09845 (ORT68_09845) 2059785..2060372 - 588 WP_001829615.1 histidine phosphatase family protein -
ORT68_RS09850 (ORT68_09850) 2060586..2060822 + 237 WP_002457224.1 hypothetical protein -
ORT68_RS09855 (ORT68_09855) 2060814..2061017 - 204 WP_001829671.1 sterile alpha motif-like domain-containing protein -
ORT68_RS09860 (ORT68_09860) 2061426..2061683 + 258 WP_002438963.1 hypothetical protein Antitoxin
ORT68_RS09865 (ORT68_09865) 2061708..2061896 + 189 WP_001829569.1 hypothetical protein Toxin
ORT68_RS09870 (ORT68_09870) 2062086..2062640 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
ORT68_RS09875 (ORT68_09875) 2062700..2062933 - 234 WP_001829664.1 hypothetical protein -
ORT68_RS09880 (ORT68_09880) 2063218..2063964 + 747 WP_001829580.1 poly-gamma-glutamate hydrolase family protein -
ORT68_RS09885 (ORT68_09885) 2064063..2064347 + 285 WP_001829635.1 hypothetical protein -
ORT68_RS09890 (ORT68_09890) 2064371..2064595 + 225 WP_001829613.1 hypothetical protein -
ORT68_RS09895 (ORT68_09895) 2065216..2065416 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2058273..2058428 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T264850 WP_001829569.1 NZ_CP111111:2061708-2061896 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT264850 WP_002438963.1 NZ_CP111111:2061426-2061683 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References