Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1011012..1011814 | Replicon | chromosome |
Accession | NZ_CP111111 | ||
Organism | Staphylococcus epidermidis strain KCTC 13172 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | ORT68_RS04895 | Protein ID | WP_002468490.1 |
Coordinates | 1011635..1011814 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | Q5HN82 |
Locus tag | ORT68_RS04890 | Protein ID | WP_002456349.1 |
Coordinates | 1011012..1011611 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORT68_RS04865 (ORT68_04865) | 1006112..1006834 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
ORT68_RS04870 (ORT68_04870) | 1007333..1008511 | + | 1179 | WP_104832450.1 | IS110-like element ISSep2 family transposase | - |
ORT68_RS04875 (ORT68_04875) | 1008910..1009047 | + | 138 | WP_162154153.1 | hypothetical protein | - |
ORT68_RS04880 (ORT68_04880) | 1009257..1010387 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
ORT68_RS04885 (ORT68_04885) | 1010384..1010854 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
ORT68_RS04890 (ORT68_04890) | 1011012..1011611 | + | 600 | WP_002456349.1 | glucosamine-6-phosphate isomerase | Antitoxin |
ORT68_RS04895 (ORT68_04895) | 1011635..1011814 | + | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
ORT68_RS04900 (ORT68_04900) | 1011970..1012374 | + | 405 | WP_001829818.1 | hypothetical protein | - |
ORT68_RS04905 (ORT68_04905) | 1012559..1013944 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
ORT68_RS04910 (ORT68_04910) | 1014261..1015439 | - | 1179 | WP_104832450.1 | IS110-like element ISSep2 family transposase | - |
ORT68_RS04915 (ORT68_04915) | 1015865..1016689 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1014261..1015334 | 1073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T264849 WP_002468490.1 NZ_CP111111:1011635-1011814 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22709.62 Da Isoelectric Point: 4.9942
>AT264849 WP_002456349.1 NZ_CP111111:1011012-1011611 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HY44 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E9LUD0 |