Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 892523..893064 | Replicon | chromosome |
Accession | NZ_CP111110 | ||
Organism | Pseudomonas chengduensis strain BC1815 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OF113_RS04050 | Protein ID | WP_266207838.1 |
Coordinates | 892523..892819 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OF113_RS04055 | Protein ID | WP_021487971.1 |
Coordinates | 892807..893064 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF113_RS04040 (OF113_04040) | 889758..891200 | + | 1443 | WP_266207836.1 | TldD/PmbA family protein | - |
OF113_RS04045 (OF113_04045) | 891200..892519 | + | 1320 | WP_266207837.1 | metallopeptidase TldD-related protein | - |
OF113_RS04050 (OF113_04050) | 892523..892819 | - | 297 | WP_266207838.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OF113_RS04055 (OF113_04055) | 892807..893064 | - | 258 | WP_021487971.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OF113_RS04060 (OF113_04060) | 893132..894256 | - | 1125 | WP_266207840.1 | class I SAM-dependent methyltransferase | - |
OF113_RS04065 (OF113_04065) | 894504..895280 | + | 777 | WP_045734041.1 | ferredoxin--NADP reductase | - |
OF113_RS04070 (OF113_04070) | 895281..896306 | - | 1026 | WP_104730348.1 | hemolysin family protein | - |
OF113_RS04075 (OF113_04075) | 896547..896795 | + | 249 | WP_266207842.1 | YdcH family protein | - |
OF113_RS04080 (OF113_04080) | 896864..897142 | + | 279 | WP_021487976.1 | DUF465 domain-containing protein | - |
OF113_RS04085 (OF113_04085) | 897404..897880 | - | 477 | WP_266207843.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11349.22 Da Isoelectric Point: 5.1297
>T264842 WP_266207838.1 NZ_CP111110:c892819-892523 [Pseudomonas chengduensis]
MAEIVWTNTALEQLADLAQYIALDKPDAARALVRRVVETVSRLVDFPLSGRVPDELPQSVYREIGVPPCRIFYRYTDATV
FIIHIMREERMLRAQMLE
MAEIVWTNTALEQLADLAQYIALDKPDAARALVRRVVETVSRLVDFPLSGRVPDELPQSVYREIGVPPCRIFYRYTDATV
FIIHIMREERMLRAQMLE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|