Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1457575..1458491 | Replicon | chromosome |
| Accession | NZ_CP111073 | ||
| Organism | Bacillus inaquosorum strain BSXE-2102 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | - |
| Locus tag | OP701_RS07170 | Protein ID | WP_060398450.1 |
| Coordinates | 1457745..1458491 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4NV07 |
| Locus tag | OP701_RS07165 | Protein ID | WP_003239095.1 |
| Coordinates | 1457575..1457745 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP701_RS07125 (OP701_07125) | 1452655..1454424 | + | 1770 | WP_248596976.1 | terminase | - |
| OP701_RS07130 (OP701_07130) | 1454436..1454765 | + | 330 | WP_060398446.1 | XkdW family protein | - |
| OP701_RS07135 (OP701_07135) | 1454762..1454926 | + | 165 | WP_019258164.1 | XkdX family protein | - |
| OP701_RS07140 (OP701_07140) | 1454973..1455812 | + | 840 | WP_060398447.1 | hypothetical protein | - |
| OP701_RS07145 (OP701_07145) | 1455865..1456134 | + | 270 | WP_060398448.1 | hemolysin XhlA family protein | - |
| OP701_RS07150 (OP701_07150) | 1456147..1456410 | + | 264 | WP_003239099.1 | phage holin | - |
| OP701_RS07155 (OP701_07155) | 1456423..1457316 | + | 894 | WP_060398449.1 | N-acetylmuramoyl-L-alanine amidase | - |
| OP701_RS07160 (OP701_07160) | 1457353..1457490 | - | 138 | WP_119913750.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| OP701_RS07165 (OP701_07165) | 1457575..1457745 | - | 171 | WP_003239095.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| OP701_RS07170 (OP701_07170) | 1457745..1458491 | - | 747 | WP_060398450.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| OP701_RS07175 (OP701_07175) | 1458601..1459602 | - | 1002 | WP_003239093.1 | inorganic phosphate transporter | - |
| OP701_RS07180 (OP701_07180) | 1459615..1460232 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| OP701_RS07185 (OP701_07185) | 1460508..1461824 | - | 1317 | WP_060398451.1 | serine/threonine exchanger | - |
| OP701_RS07190 (OP701_07190) | 1462210..1463160 | + | 951 | WP_060398452.1 | ring-cleaving dioxygenase | - |
| OP701_RS07195 (OP701_07195) | 1463261..1463406 | + | 146 | Protein_1354 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29097.57 Da Isoelectric Point: 4.6191
>T264841 WP_060398450.1 NZ_CP111073:c1458491-1457745 [Bacillus inaquosorum]
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQNRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQNRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|