Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 517991..518627 | Replicon | chromosome |
Accession | NZ_CP111073 | ||
Organism | Bacillus inaquosorum strain BSXE-2102 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OP701_RS02625 | Protein ID | WP_003156187.1 |
Coordinates | 518277..518627 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | OP701_RS02620 | Protein ID | WP_003225183.1 |
Coordinates | 517991..518272 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP701_RS02600 (OP701_02600) | 514352..514951 | - | 600 | WP_003240338.1 | rhomboid family intramembrane serine protease | - |
OP701_RS02605 (OP701_02605) | 515046..515411 | + | 366 | WP_003240339.1 | holo-ACP synthase | - |
OP701_RS02610 (OP701_02610) | 515576..516592 | + | 1017 | WP_080010740.1 | outer membrane lipoprotein carrier protein LolA | - |
OP701_RS02615 (OP701_02615) | 516707..517876 | + | 1170 | WP_060397966.1 | alanine racemase | - |
OP701_RS02620 (OP701_02620) | 517991..518272 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OP701_RS02625 (OP701_02625) | 518277..518627 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OP701_RS02630 (OP701_02630) | 518742..519566 | + | 825 | WP_003240350.1 | RsbT co-antagonist protein RsbRA | - |
OP701_RS02635 (OP701_02635) | 519571..519936 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
OP701_RS02640 (OP701_02640) | 519940..520341 | + | 402 | WP_003240352.1 | serine/threonine-protein kinase RsbT | - |
OP701_RS02645 (OP701_02645) | 520353..521360 | + | 1008 | WP_003240354.1 | phosphoserine phosphatase RsbU | - |
OP701_RS02650 (OP701_02650) | 521422..521751 | + | 330 | WP_003240357.1 | anti-sigma factor antagonist RsbV | - |
OP701_RS02655 (OP701_02655) | 521748..522230 | + | 483 | WP_003240359.1 | anti-sigma B factor RsbW | - |
OP701_RS02660 (OP701_02660) | 522196..522984 | + | 789 | WP_003240361.1 | RNA polymerase sigma factor SigB | - |
OP701_RS02665 (OP701_02665) | 522984..523583 | + | 600 | WP_060397967.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T264840 WP_003156187.1 NZ_CP111073:518277-518627 [Bacillus inaquosorum]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|