Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1210206..1211123 | Replicon | chromosome |
Accession | NZ_CP111072 | ||
Organism | Bacillus velezensis strain YFI-E109 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | OQE53_RS06350 | Protein ID | WP_007407256.1 |
Coordinates | 1210377..1211123 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | OQE53_RS06345 | Protein ID | WP_003154807.1 |
Coordinates | 1210206..1210376 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQE53_RS06305 | 1205439..1207061 | + | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
OQE53_RS06310 | 1207074..1207445 | + | 372 | WP_032874603.1 | XkdW family protein | - |
OQE53_RS06315 | 1207450..1207647 | + | 198 | WP_032874605.1 | XkdX family protein | - |
OQE53_RS06320 | 1207704..1208465 | + | 762 | WP_032874607.1 | hypothetical protein | - |
OQE53_RS06325 | 1208517..1208780 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
OQE53_RS06330 | 1208794..1209057 | + | 264 | WP_003154813.1 | phage holin | - |
OQE53_RS06335 | 1209071..1209949 | + | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
OQE53_RS06340 | 1209984..1210109 | - | 126 | WP_003154809.1 | hypothetical protein | - |
OQE53_RS06345 | 1210206..1210376 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OQE53_RS06350 | 1210377..1211123 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OQE53_RS06355 | 1211228..1212226 | - | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
OQE53_RS06360 | 1212239..1212856 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
OQE53_RS06365 | 1213142..1214458 | - | 1317 | WP_032874616.1 | amino acid permease | - |
OQE53_RS06370 | 1214780..1215730 | + | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T264839 WP_007407256.1 NZ_CP111072:c1211123-1210377 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|