Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 458970..459607 | Replicon | chromosome |
Accession | NZ_CP111072 | ||
Organism | Bacillus velezensis strain YFI-E109 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OQE53_RS02365 | Protein ID | WP_003156187.1 |
Coordinates | 459257..459607 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | OQE53_RS02360 | Protein ID | WP_003156188.1 |
Coordinates | 458970..459251 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQE53_RS02340 | 455336..455935 | - | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
OQE53_RS02345 | 456028..456393 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
OQE53_RS02350 | 456558..457565 | + | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
OQE53_RS02355 | 457681..458850 | + | 1170 | WP_032873001.1 | alanine racemase | - |
OQE53_RS02360 | 458970..459251 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OQE53_RS02365 | 459257..459607 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OQE53_RS02370 | 459725..460546 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
OQE53_RS02375 | 460551..460916 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
OQE53_RS02380 | 460919..461320 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
OQE53_RS02385 | 461332..462339 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
OQE53_RS02390 | 462403..462732 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
OQE53_RS02395 | 462729..463211 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
OQE53_RS02400 | 463177..463965 | + | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
OQE53_RS02405 | 463965..464567 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T264838 WP_003156187.1 NZ_CP111072:459257-459607 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|