Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 205178..205871 | Replicon | plasmid pPALA50 |
Accession | NZ_CP111035 | ||
Organism | Pseudomonas aeruginosa strain PALA50 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | PALA50_RS31090 | Protein ID | WP_003151133.1 |
Coordinates | 205494..205871 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | PALA50_RS31085 | Protein ID | WP_001172026.1 |
Coordinates | 205178..205513 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA50_RS31045 (PALA50_06134) | 200920..201489 | + | 570 | WP_023121486.1 | LemA family protein | - |
PALA50_RS31050 (PALA50_06135) | 201571..202038 | + | 468 | WP_042853536.1 | hypothetical protein | - |
PALA50_RS31055 (PALA50_06136) | 202207..203181 | + | 975 | WP_042853537.1 | SGNH/GDSL hydrolase family protein | - |
PALA50_RS31060 (PALA50_06137) | 203205..203885 | - | 681 | WP_049267373.1 | hypothetical protein | - |
PALA50_RS31065 | 203882..204007 | - | 126 | WP_256675080.1 | hypothetical protein | - |
PALA50_RS31070 (PALA50_06138) | 204110..204481 | - | 372 | WP_023103794.1 | hypothetical protein | - |
PALA50_RS31075 (PALA50_06139) | 204478..204804 | - | 327 | WP_000091614.1 | hypothetical protein | - |
PALA50_RS31080 (PALA50_06140) | 204828..205163 | - | 336 | WP_000741275.1 | hypothetical protein | - |
PALA50_RS31085 (PALA50_06141) | 205178..205513 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PALA50_RS31090 (PALA50_06142) | 205494..205871 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA50_RS31095 (PALA50_06143) | 206063..206665 | + | 603 | WP_010465829.1 | recombinase family protein | - |
PALA50_RS31100 (PALA50_06144) | 206649..209678 | + | 3030 | WP_010799689.1 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..222021 | 222021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T264837 WP_003151133.1 NZ_CP111035:c205871-205494 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |