Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 194817..195456 | Replicon | plasmid pPALA50 |
Accession | NZ_CP111035 | ||
Organism | Pseudomonas aeruginosa strain PALA50 |
Toxin (Protein)
Gene name | tad | Uniprot ID | Q4W1R0 |
Locus tag | PALA50_RS31000 | Protein ID | WP_011270175.1 |
Coordinates | 194817..195140 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | PALA50_RS31005 | Protein ID | WP_001172026.1 |
Coordinates | 195121..195456 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA50_RS30965 (PALA50_06119) | 190216..190650 | + | 435 | WP_063839983.1 | hypothetical protein | - |
PALA50_RS30970 (PALA50_06120) | 190694..191107 | - | 414 | WP_023121403.1 | hypothetical protein | - |
PALA50_RS30975 (PALA50_06121) | 191107..192276 | - | 1170 | WP_023121402.1 | ParB N-terminal domain-containing protein | - |
PALA50_RS30980 (PALA50_06122) | 192273..193268 | - | 996 | WP_023121401.1 | ParA family protein | - |
PALA50_RS30985 | 193431..193853 | + | 423 | WP_023121400.1 | hypothetical protein | - |
PALA50_RS30990 | 193879..194292 | + | 414 | WP_042853487.1 | hypothetical protein | - |
PALA50_RS30995 (PALA50_06124) | 194289..194753 | + | 465 | WP_042853485.1 | RES family NAD+ phosphorylase | - |
PALA50_RS31000 (PALA50_06125) | 194817..195140 | + | 324 | WP_011270175.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA50_RS31005 (PALA50_06126) | 195121..195456 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PALA50_RS31010 (PALA50_06127) | 195471..195806 | + | 336 | WP_000741275.1 | hypothetical protein | - |
PALA50_RS31015 (PALA50_06128) | 195830..196156 | + | 327 | WP_000091614.1 | hypothetical protein | - |
PALA50_RS31020 (PALA50_06129) | 196153..196524 | + | 372 | WP_023103794.1 | hypothetical protein | - |
PALA50_RS31025 (PALA50_06130) | 196555..196737 | - | 183 | WP_269974169.1 | hypothetical protein | - |
PALA50_RS31030 (PALA50_06131) | 196753..198786 | - | 2034 | WP_124124906.1 | hypothetical protein | - |
PALA50_RS31035 (PALA50_06132) | 198898..199467 | + | 570 | WP_023121215.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..222021 | 222021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11596.35 Da Isoelectric Point: 9.5275
>T264836 WP_011270175.1 NZ_CP111035:194817-195140 [Pseudomonas aeruginosa]
MALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAVFVLHCFQKKSKSGIATPK
ADMDIIRARLKVAEVLAQELRNAKTNH
MALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAVFVLHCFQKKSKSGIATPK
ADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4W1R0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |