Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 170690..171240 | Replicon | plasmid pPALA54 |
| Accession | NZ_CP111033 | ||
| Organism | Pseudomonas aeruginosa strain PALA54 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PALA54_RS32945 | Protein ID | WP_034061810.1 |
| Coordinates | 170690..170968 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PALA54_RS32950 | Protein ID | WP_034061812.1 |
| Coordinates | 170968..171240 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA54_RS32925 (PALA54_06501) | 167233..169083 | + | 1851 | WP_049267175.1 | tyrosine-type recombinase/integrase | - |
| PALA54_RS32930 | 169080..169592 | + | 513 | WP_044305333.1 | hypothetical protein | - |
| PALA54_RS32935 (PALA54_06502) | 169605..169847 | - | 243 | WP_034061808.1 | hypothetical protein | - |
| PALA54_RS32940 (PALA54_06503) | 169861..170688 | - | 828 | WP_034061809.1 | hypothetical protein | - |
| PALA54_RS32945 (PALA54_06504) | 170690..170968 | - | 279 | WP_034061810.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA54_RS32950 (PALA54_06505) | 170968..171240 | - | 273 | WP_034061812.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PALA54_RS32955 | 171434..171874 | - | 441 | WP_128734628.1 | hypothetical protein | - |
| PALA54_RS32960 (PALA54_06506) | 171884..172630 | - | 747 | WP_034061813.1 | DUF2807 domain-containing protein | - |
| PALA54_RS32965 (PALA54_06507) | 172772..173920 | - | 1149 | WP_034061814.1 | site-specific integrase | - |
| PALA54_RS32970 (PALA54_06508) | 174082..174894 | - | 813 | Protein_211 | site-specific integrase | - |
| PALA54_RS32975 (PALA54_06509) | 174860..175126 | - | 267 | WP_034061816.1 | helix-turn-helix transcriptional regulator | - |
| PALA54_RS32980 (PALA54_06510) | 175264..175929 | - | 666 | WP_034061819.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..177374 | 177374 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10844.46 Da Isoelectric Point: 8.5041
>T264830 WP_034061810.1 NZ_CP111033:c170968-170690 [Pseudomonas aeruginosa]
MELKWTSKALSDLARLYEFLAAVNRPAAARTVQQLTVTPTTLLTNPRIGERLEEFEPRDVRRILVGHYEMRYEIAADSTI
YLLRLWHTREDR
MELKWTSKALSDLARLYEFLAAVNRPAAARTVQQLTVTPTTLLTNPRIGERLEEFEPRDVRRILVGHYEMRYEIAADSTI
YLLRLWHTREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|