Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5198491..5199099 | Replicon | chromosome |
Accession | NZ_CP111032 | ||
Organism | Pseudomonas aeruginosa strain PALA54 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | PALA54_RS24395 | Protein ID | WP_019486378.1 |
Coordinates | 5198491..5198838 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA54_RS24400 | Protein ID | WP_003114155.1 |
Coordinates | 5198848..5199099 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA54_RS24375 (PALA54_04824) | 5194424..5194921 | + | 498 | WP_116850177.1 | heat resistance protein PsiE-GI | - |
PALA54_RS24380 (PALA54_04825) | 5194899..5195864 | + | 966 | WP_112778053.1 | zinc metalloprotease HtpX | - |
PALA54_RS24385 (PALA54_04826) | 5195889..5197040 | + | 1152 | WP_004265443.1 | trypsin-like peptidase domain-containing protein | - |
PALA54_RS24390 (PALA54_04827) | 5197273..5198181 | + | 909 | WP_003141085.1 | LysR family transcriptional regulator | - |
PALA54_RS24395 (PALA54_04828) | 5198491..5198838 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA54_RS24400 | 5198848..5199099 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA54_RS24405 (PALA54_04829) | 5199313..5200296 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
PALA54_RS24410 (PALA54_04830) | 5200296..5201588 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
PALA54_RS24415 (PALA54_04832) | 5201818..5203101 | - | 1284 | WP_023124144.1 | zonular occludens toxin family protein | - |
PALA54_RS24420 (PALA54_04833) | 5203105..5203461 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5116622..5210346 | 93724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T264828 WP_019486378.1 NZ_CP111032:c5198838-5198491 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |