Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 2658469..2659511 | Replicon | chromosome |
| Accession | NZ_CP111032 | ||
| Organism | Pseudomonas aeruginosa strain PALA54 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | PALA54_RS12645 | Protein ID | WP_003109777.1 |
| Coordinates | 2658936..2659511 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | PALA54_RS12640 | Protein ID | WP_003050245.1 |
| Coordinates | 2658469..2658939 (+) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA54_RS12605 (PALA54_02499) | 2653861..2655279 | - | 1419 | WP_003109776.1 | TIGR03752 family integrating conjugative element protein | - |
| PALA54_RS12610 (PALA54_02500) | 2655269..2656180 | - | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
| PALA54_RS12615 (PALA54_02501) | 2656177..2656869 | - | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
| PALA54_RS12620 (PALA54_02502) | 2656866..2657264 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
| PALA54_RS12625 (PALA54_02503) | 2657276..2657635 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PALA54_RS12630 (PALA54_02504) | 2657652..2657885 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
| PALA54_RS12635 (PALA54_02505) | 2657882..2658265 | - | 384 | WP_003105635.1 | RAQPRD family integrative conjugative element protein | - |
| PALA54_RS12640 (PALA54_02506) | 2658469..2658939 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PALA54_RS12645 (PALA54_02507) | 2658936..2659511 | + | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
| PALA54_RS12650 (PALA54_02508) | 2659529..2660443 | + | 915 | WP_043084563.1 | AAA family ATPase | - |
| PALA54_RS12655 (PALA54_02509) | 2660440..2660910 | + | 471 | WP_003105626.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| PALA54_RS12660 (PALA54_02510) | 2660907..2661407 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| PALA54_RS12665 (PALA54_02511) | 2661407..2662309 | + | 903 | WP_003105624.1 | CBASS oligonucleotide cyclase | - |
| PALA54_RS12670 (PALA54_02512) | 2662348..2663073 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2608649..2704746 | 96097 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T264824 WP_003109777.1 NZ_CP111032:2658936-2659511 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT264824 WP_003050245.1 NZ_CP111032:2658469-2658939 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|