Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2658469..2659511 Replicon chromosome
Accession NZ_CP111032
Organism Pseudomonas aeruginosa strain PALA54

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PALA54_RS12645 Protein ID WP_003109777.1
Coordinates 2658936..2659511 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PALA54_RS12640 Protein ID WP_003050245.1
Coordinates 2658469..2658939 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA54_RS12605 (PALA54_02499) 2653861..2655279 - 1419 WP_003109776.1 TIGR03752 family integrating conjugative element protein -
PALA54_RS12610 (PALA54_02500) 2655269..2656180 - 912 WP_003105643.1 TIGR03749 family integrating conjugative element protein -
PALA54_RS12615 (PALA54_02501) 2656177..2656869 - 693 WP_003105641.1 TIGR03746 family integrating conjugative element protein -
PALA54_RS12620 (PALA54_02502) 2656866..2657264 - 399 WP_003105639.1 TIGR03750 family conjugal transfer protein -
PALA54_RS12625 (PALA54_02503) 2657276..2657635 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
PALA54_RS12630 (PALA54_02504) 2657652..2657885 - 234 WP_003050225.1 TIGR03758 family integrating conjugative element protein -
PALA54_RS12635 (PALA54_02505) 2657882..2658265 - 384 WP_003105635.1 RAQPRD family integrative conjugative element protein -
PALA54_RS12640 (PALA54_02506) 2658469..2658939 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PALA54_RS12645 (PALA54_02507) 2658936..2659511 + 576 WP_003109777.1 PIN domain-containing protein Toxin
PALA54_RS12650 (PALA54_02508) 2659529..2660443 + 915 WP_043084563.1 AAA family ATPase -
PALA54_RS12655 (PALA54_02509) 2660440..2660910 + 471 WP_003105626.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PALA54_RS12660 (PALA54_02510) 2660907..2661407 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PALA54_RS12665 (PALA54_02511) 2661407..2662309 + 903 WP_003105624.1 CBASS oligonucleotide cyclase -
PALA54_RS12670 (PALA54_02512) 2662348..2663073 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2608649..2704746 96097


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21644.79 Da        Isoelectric Point: 5.6172

>T264824 WP_003109777.1 NZ_CP111032:2658936-2659511 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT264824 WP_003050245.1 NZ_CP111032:2658469-2658939 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References