Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 5156432..5157040 | Replicon | chromosome |
| Accession | NZ_CP111030 | ||
| Organism | Pseudomonas aeruginosa strain PALA38 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | A0A444LUU5 |
| Locus tag | PALA38_RS24160 | Protein ID | WP_019486378.1 |
| Coordinates | 5156432..5156779 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | A0A0B0C355 |
| Locus tag | PALA38_RS24165 | Protein ID | WP_003114155.1 |
| Coordinates | 5156789..5157040 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA38_RS24140 (PALA38_04770) | 5152365..5152862 | + | 498 | WP_116850177.1 | heat resistance protein PsiE-GI | - |
| PALA38_RS24145 (PALA38_04771) | 5152840..5153805 | + | 966 | WP_112778053.1 | zinc metalloprotease HtpX | - |
| PALA38_RS24150 (PALA38_04772) | 5153830..5154981 | + | 1152 | WP_004265443.1 | trypsin-like peptidase domain-containing protein | - |
| PALA38_RS24155 (PALA38_04773) | 5155214..5156122 | + | 909 | WP_003141085.1 | LysR family transcriptional regulator | - |
| PALA38_RS24160 (PALA38_04774) | 5156432..5156779 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA38_RS24165 | 5156789..5157040 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PALA38_RS24170 (PALA38_04775) | 5157254..5158237 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
| PALA38_RS24175 (PALA38_04776) | 5158237..5159529 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
| PALA38_RS24180 (PALA38_04778) | 5159759..5161042 | - | 1284 | WP_023124144.1 | zonular occludens toxin family protein | - |
| PALA38_RS24185 (PALA38_04779) | 5161046..5161402 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5074563..5168287 | 93724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T264820 WP_019486378.1 NZ_CP111030:c5156779-5156432 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A444LUU5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B0C355 |