Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2657672..2658714 | Replicon | chromosome |
Accession | NZ_CP111030 | ||
Organism | Pseudomonas aeruginosa strain PALA38 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA38_RS12635 | Protein ID | WP_003109777.1 |
Coordinates | 2658139..2658714 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA38_RS12630 | Protein ID | WP_003050245.1 |
Coordinates | 2657672..2658142 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA38_RS12595 (PALA38_02494) | 2653064..2654482 | - | 1419 | WP_003109776.1 | TIGR03752 family integrating conjugative element protein | - |
PALA38_RS12600 (PALA38_02495) | 2654472..2655383 | - | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
PALA38_RS12605 (PALA38_02496) | 2655380..2656072 | - | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
PALA38_RS12610 (PALA38_02497) | 2656069..2656467 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
PALA38_RS12615 (PALA38_02498) | 2656479..2656838 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA38_RS12620 (PALA38_02499) | 2656855..2657088 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA38_RS12625 (PALA38_02500) | 2657085..2657468 | - | 384 | WP_003105635.1 | RAQPRD family integrative conjugative element protein | - |
PALA38_RS12630 (PALA38_02501) | 2657672..2658142 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA38_RS12635 (PALA38_02502) | 2658139..2658714 | + | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
PALA38_RS12640 (PALA38_02503) | 2658732..2659646 | + | 915 | WP_043084563.1 | AAA family ATPase | - |
PALA38_RS12645 (PALA38_02504) | 2659643..2660113 | + | 471 | WP_003105626.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA38_RS12650 (PALA38_02505) | 2660110..2660610 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA38_RS12655 (PALA38_02506) | 2660610..2661512 | + | 903 | WP_003105624.1 | CBASS oligonucleotide cyclase | - |
PALA38_RS12660 (PALA38_02507) | 2661551..2662276 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2607852..2703949 | 96097 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T264816 WP_003109777.1 NZ_CP111030:2658139-2658714 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT264816 WP_003050245.1 NZ_CP111030:2657672-2658142 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|