Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4108636..4109417 | Replicon | chromosome |
Accession | NZ_CP111029 | ||
Organism | Salmonella sp. 2018103 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A752VN12 |
Locus tag | OLG56_RS19895 | Protein ID | WP_000622305.1 |
Coordinates | 4108636..4109127 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A3V4SIN7 |
Locus tag | OLG56_RS19900 | Protein ID | WP_001110453.1 |
Coordinates | 4109124..4109417 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLG56_RS19870 (4105590) | 4105590..4106420 | - | 831 | WP_079980926.1 | fimbria/pilus periplasmic chaperone | - |
OLG56_RS19875 (4106622) | 4106622..4106927 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
OLG56_RS19880 (4107459) | 4107459..4107602 | + | 144 | Protein_3884 | transposase | - |
OLG56_RS19885 (4107619) | 4107619..4107879 | + | 261 | Protein_3885 | Rpn family recombination-promoting nuclease/putative transposase | - |
OLG56_RS19890 (4108168) | 4108168..4108401 | - | 234 | Protein_3886 | IS481 family transposase | - |
OLG56_RS19895 (4108636) | 4108636..4109127 | - | 492 | WP_000622305.1 | GNAT family N-acetyltransferase | Toxin |
OLG56_RS19900 (4109124) | 4109124..4109417 | - | 294 | WP_001110453.1 | DUF1778 domain-containing protein | Antitoxin |
OLG56_RS19905 (4109741) | 4109741..4109963 | + | 223 | Protein_3889 | hypothetical protein | - |
OLG56_RS19910 (4110227) | 4110227..4111102 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
OLG56_RS19915 (4111099) | 4111099..4111386 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
OLG56_RS19920 (4111379) | 4111379..4111561 | - | 183 | WP_001527266.1 | ATP-binding cassette domain-containing protein | - |
OLG56_RS19925 (4111581) | 4111581..4111680 | + | 100 | Protein_3893 | hypothetical protein | - |
OLG56_RS19930 (4111790) | 4111790..4111924 | + | 135 | Protein_3894 | hypothetical protein | - |
OLG56_RS19935 (4112219) | 4112219..4113124 | - | 906 | WP_001268209.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4098102..4111561 | 13459 | |
- | flank | IS/Tn | - | - | 4107625..4107888 | 263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T264811 WP_000622305.1 NZ_CP111029:c4109127-4108636 [Salmonella sp. 2018103]
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752VN12 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIN7 |