Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3994965..3995481 | Replicon | chromosome |
Accession | NZ_CP111029 | ||
Organism | Salmonella sp. 2018103 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | OLG56_RS19270 | Protein ID | WP_000220578.1 |
Coordinates | 3994965..3995249 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A5I1C3W3 |
Locus tag | OLG56_RS19275 | Protein ID | WP_000212722.1 |
Coordinates | 3995239..3995481 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLG56_RS19255 (3990081) | 3990081..3991733 | + | 1653 | WP_000155039.1 | alpha,alpha-phosphotrehalase | - |
OLG56_RS19260 (3992142) | 3992142..3994280 | + | 2139 | WP_000187815.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OLG56_RS19265 (3994497) | 3994497..3994961 | + | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OLG56_RS19270 (3994965) | 3994965..3995249 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OLG56_RS19275 (3995239) | 3995239..3995481 | - | 243 | WP_000212722.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OLG56_RS19280 (3995559) | 3995559..3997472 | - | 1914 | WP_139763604.1 | BglG family transcription antiterminator | - |
OLG56_RS19285 (3997489) | 3997489..3998229 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
OLG56_RS19290 (3998226) | 3998226..3999344 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OLG56_RS19295 (3999328) | 3999328..4000461 | - | 1134 | WP_001609909.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T264810 WP_000220578.1 NZ_CP111029:c3995249-3994965 [Salmonella sp. 2018103]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1C3W3 |