Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 3954337..3954887 | Replicon | chromosome |
Accession | NZ_CP111029 | ||
Organism | Salmonella sp. 2018103 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | OLG56_RS19065 | Protein ID | WP_001199743.1 |
Coordinates | 3954337..3954645 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | OLG56_RS19070 | Protein ID | WP_000016244.1 |
Coordinates | 3954648..3954887 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLG56_RS19050 (3952365) | 3952365..3953144 | - | 780 | WP_001088805.1 | HNH endonuclease | - |
OLG56_RS19055 (3953305) | 3953305..3953619 | + | 315 | WP_061377152.1 | hypothetical protein | - |
OLG56_RS19060 (3953616) | 3953616..3953903 | - | 288 | WP_061377153.1 | Arm DNA-binding domain-containing protein | - |
OLG56_RS19065 (3954337) | 3954337..3954645 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
OLG56_RS19070 (3954648) | 3954648..3954887 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
OLG56_RS19075 (3954996) | 3954996..3955220 | - | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
OLG56_RS19085 (3956005) | 3956005..3957024 | + | 1020 | WP_000152564.1 | NAD(P)-dependent alcohol dehydrogenase | - |
OLG56_RS19090 (3957052) | 3957052..3957582 | - | 531 | WP_000896756.1 | gluconokinase | - |
OLG56_RS19095 (3957799) | 3957799..3958830 | + | 1032 | WP_000453351.1 | L-idonate 5-dehydrogenase | - |
OLG56_RS19100 (3958855) | 3958855..3959619 | + | 765 | WP_000998688.1 | gluconate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T264809 WP_001199743.1 NZ_CP111029:c3954645-3954337 [Salmonella sp. 2018103]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |