Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3304870..3305490 | Replicon | chromosome |
| Accession | NZ_CP111029 | ||
| Organism | Salmonella sp. 2018103 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | OLG56_RS16110 | Protein ID | WP_001280991.1 |
| Coordinates | 3305272..3305490 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | OLG56_RS16105 | Protein ID | WP_000344807.1 |
| Coordinates | 3304870..3305244 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLG56_RS16095 (3300009) | 3300009..3301202 | + | 1194 | WP_079980911.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OLG56_RS16100 (3301225) | 3301225..3304374 | + | 3150 | WP_039512904.1 | efflux RND transporter permease AcrB | - |
| OLG56_RS16105 (3304870) | 3304870..3305244 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| OLG56_RS16110 (3305272) | 3305272..3305490 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| OLG56_RS16115 (3305669) | 3305669..3306220 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
| OLG56_RS16120 (3306338) | 3306338..3306808 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| OLG56_RS16125 (3306864) | 3306864..3307004 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| OLG56_RS16130 (3307010) | 3307010..3307270 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| OLG56_RS16135 (3307495) | 3307495..3309045 | + | 1551 | WP_001642888.1 | EAL domain-containing protein | - |
| OLG56_RS16145 (3309276) | 3309276..3309665 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| OLG56_RS16150 (3309698) | 3309698..3310267 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T264808 WP_001280991.1 NZ_CP111029:3305272-3305490 [Salmonella sp. 2018103]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT264808 WP_000344807.1 NZ_CP111029:3304870-3305244 [Salmonella sp. 2018103]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|