Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2248431..2248953 | Replicon | chromosome |
Accession | NZ_CP111029 | ||
Organism | Salmonella sp. 2018103 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5J1ICX1 |
Locus tag | OLG56_RS10925 | Protein ID | WP_000221344.1 |
Coordinates | 2248431..2248715 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | OLG56_RS10930 | Protein ID | WP_000885424.1 |
Coordinates | 2248705..2248953 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLG56_RS10900 (2243435) | 2243435..2244676 | - | 1242 | WP_001095734.1 | MFS transporter | - |
OLG56_RS10905 (2244666) | 2244666..2246174 | - | 1509 | WP_053258905.1 | FAD-dependent oxidoreductase | - |
OLG56_RS10910 (2246219) | 2246219..2246707 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OLG56_RS10915 (2246900) | 2246900..2247979 | + | 1080 | WP_079900464.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
OLG56_RS10920 (2248031) | 2248031..2248312 | - | 282 | Protein_2134 | RidA family protein | - |
OLG56_RS10925 (2248431) | 2248431..2248715 | - | 285 | WP_000221344.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OLG56_RS10930 (2248705) | 2248705..2248953 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OLG56_RS10935 (2249105) | 2249105..2249224 | + | 120 | Protein_2137 | type II and III secretion system | - |
OLG56_RS10940 (2249310) | 2249310..2249642 | + | 333 | WP_000253078.1 | DUF1493 family protein | - |
OLG56_RS10945 (2249917) | 2249917..2250087 | - | 171 | WP_000415762.1 | DUF29 family protein | - |
OLG56_RS10950 (2250499) | 2250499..2251407 | + | 909 | WP_001176637.1 | LysR family transcriptional regulator | - |
OLG56_RS10955 (2251581) | 2251581..2252561 | + | 981 | WP_000876807.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11015.73 Da Isoelectric Point: 10.5388
>T264803 WP_000221344.1 NZ_CP111029:c2248715-2248431 [Salmonella sp. 2018103]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5J1ICX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |