Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 826300..826960 | Replicon | chromosome |
| Accession | NZ_CP111029 | ||
| Organism | Salmonella sp. 2018103 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A5I1G658 |
| Locus tag | OLG56_RS03975 | Protein ID | WP_001727955.1 |
| Coordinates | 826547..826960 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | OLG56_RS03970 | Protein ID | WP_000351186.1 |
| Coordinates | 826300..826566 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLG56_RS03950 (822229) | 822229..823662 | - | 1434 | WP_001230152.1 | 6-phospho-beta-glucosidase BglA | - |
| OLG56_RS03955 (823820) | 823820..824131 | + | 312 | WP_001182972.1 | N(4)-acetylcytidine aminohydrolase | - |
| OLG56_RS03960 (824295) | 824295..824954 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| OLG56_RS03965 (825070) | 825070..826050 | - | 981 | WP_000874169.1 | tRNA-modifying protein YgfZ | - |
| OLG56_RS03970 (826300) | 826300..826566 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| OLG56_RS03975 (826547) | 826547..826960 | + | 414 | WP_001727955.1 | protein YgfX | Toxin |
| OLG56_RS03980 (827013) | 827013..827534 | - | 522 | WP_052942704.1 | flavodoxin FldB | - |
| OLG56_RS03985 (827647) | 827647..828543 | + | 897 | WP_000434300.1 | site-specific tyrosine recombinase XerD | - |
| OLG56_RS03990 (828567) | 828567..829280 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OLG56_RS03995 (829286) | 829286..831019 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16201.18 Da Isoelectric Point: 10.7537
>T264802 WP_001727955.1 NZ_CP111029:826547-826960 [Salmonella sp. 2018103]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMMLLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMMLLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I1G658 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |