264801

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 308498..309084 Replicon chromosome
Accession NZ_CP111029
Organism Salmonella sp. 2018103

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag OLG56_RS01425 Protein ID WP_000174963.1
Coordinates 308716..309084 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag OLG56_RS01420 Protein ID WP_001635839.1
Coordinates 308498..308719 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLG56_RS01395 (303519) 303519..304628 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
OLG56_RS01400 (304688) 304688..305614 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OLG56_RS01405 (305611) 305611..306888 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
OLG56_RS01410 (306885) 306885..307652 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OLG56_RS01415 (307654) 307654..308367 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OLG56_RS01420 (308498) 308498..308719 + 222 WP_001635839.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OLG56_RS01425 (308716) 308716..309084 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OLG56_RS01430 (309343) 309343..310659 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OLG56_RS01435 (310764) 310764..311651 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OLG56_RS01440 (311648) 311648..312493 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OLG56_RS01445 (312496) 312496..313566 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 305611..314303 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T264801 WP_000174963.1 NZ_CP111029:308716-309084 [Salmonella sp. 2018103]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8176.21 Da        Isoelectric Point: 5.0775

>AT264801 WP_001635839.1 NZ_CP111029:308498-308719 [Salmonella sp. 2018103]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKPAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure

References