Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 204334..205094 | Replicon | chromosome |
Accession | NZ_CP111029 | ||
Organism | Salmonella sp. 2018103 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | OLG56_RS00960 | Protein ID | WP_000533909.1 |
Coordinates | 204609..205094 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | OLG56_RS00955 | Protein ID | WP_000965886.1 |
Coordinates | 204334..204621 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLG56_RS00930 (200333) | 200333..200788 | + | 456 | Protein_184 | IS3 family transposase | - |
OLG56_RS00935 (200912) | 200912..201700 | + | 789 | Protein_185 | IS3 family transposase | - |
OLG56_RS00940 (202013) | 202013..202669 | + | 657 | WP_235596638.1 | hypothetical protein | - |
OLG56_RS00945 (202717) | 202717..203004 | + | 288 | WP_235596639.1 | HNH endonuclease | - |
OLG56_RS00950 (203075) | 203075..203701 | - | 627 | WP_130559547.1 | hypothetical protein | - |
OLG56_RS00955 (204334) | 204334..204621 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
OLG56_RS00960 (204609) | 204609..205094 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
OLG56_RS00965 (205466) | 205466..206005 | - | 540 | WP_000047140.1 | copper-binding periplasmic metallochaperone CueP | - |
OLG56_RS00970 (206178) | 206178..206390 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
OLG56_RS00975 (206678) | 206678..206968 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
OLG56_RS00980 (207407) | 207407..208117 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
OLG56_RS00985 (208167) | 208167..209141 | - | 975 | WP_000804678.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
OLG56_RS00990 (209360) | 209360..210022 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T264800 WP_000533909.1 NZ_CP111029:204609-205094 [Salmonella sp. 2018103]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK8 | |
AlphaFold DB | A0A3V2JDX2 |