Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 195331..196001 Replicon plasmid p130-1
Accession NZ_CP111009
Organism Escherichia coli strain J53-p130

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag ORI87_RS23845 Protein ID WP_004213072.1
Coordinates 195331..195774 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag ORI87_RS23850 Protein ID WP_004213073.1
Coordinates 195771..196001 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI87_RS23810 (ORI87_23810) 190741..191016 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
ORI87_RS23815 (ORI87_23815) 191079..191570 + 492 WP_011251327.1 DM13 domain-containing protein -
ORI87_RS23820 (ORI87_23820) 191619..192539 + 921 WP_004213934.1 DUF1471 domain-containing protein -
ORI87_RS23825 (ORI87_23825) 192630..193033 + 404 Protein_207 GAF domain-containing protein -
ORI87_RS23830 (ORI87_23830) 193551..194187 - 637 Protein_208 mucoid phenotype regulator RmpA2 -
ORI87_RS23835 (ORI87_23835) 194604..194908 + 305 Protein_209 transposase -
ORI87_RS23840 (ORI87_23840) 194931..195182 - 252 WP_186987481.1 hypothetical protein -
ORI87_RS23845 (ORI87_23845) 195331..195774 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
ORI87_RS23850 (ORI87_23850) 195771..196001 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORI87_RS23855 (ORI87_23855) 196609..197742 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
ORI87_RS23860 (ORI87_23860) 197758..198051 + 294 WP_004213076.1 hypothetical protein -
ORI87_RS23865 (ORI87_23865) 198041..198247 - 207 WP_004213077.1 hypothetical protein -
ORI87_RS23870 (ORI87_23870) 198599..198889 + 291 WP_004213078.1 hypothetical protein -
ORI87_RS23875 (ORI87_23875) 198879..199778 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 1..226559 226559


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T264799 WP_004213072.1 NZ_CP111009:c195774-195331 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT264799 WP_004213073.1 NZ_CP111009:c196001-195771 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References