Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 157996..158732 | Replicon | plasmid p130-1 |
Accession | NZ_CP111009 | ||
Organism | Escherichia coli strain J53-p130 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J5Q928 |
Locus tag | ORI87_RS23625 | Protein ID | WP_004098919.1 |
Coordinates | 158250..158732 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
Locus tag | ORI87_RS23620 | Protein ID | WP_004213599.1 |
Coordinates | 157996..158262 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI87_RS23595 (ORI87_23595) | 153228..153785 | + | 558 | WP_004213590.1 | recombinase family protein | - |
ORI87_RS23600 (ORI87_23600) | 153788..156757 | + | 2970 | WP_004213592.1 | Tn3 family transposase | - |
ORI87_RS23605 (ORI87_23605) | 156799..157293 | + | 495 | WP_004213594.1 | hypothetical protein | - |
ORI87_RS23610 (ORI87_23610) | 157354..157557 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
ORI87_RS23615 (ORI87_23615) | 157571..157801 | + | 231 | WP_004213598.1 | hypothetical protein | - |
ORI87_RS23620 (ORI87_23620) | 157996..158262 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
ORI87_RS23625 (ORI87_23625) | 158250..158732 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
ORI87_RS23630 (ORI87_23630) | 159153..160380 | + | 1228 | Protein_168 | IS3 family transposase | - |
ORI87_RS23635 (ORI87_23635) | 160376..160771 | - | 396 | Protein_169 | IS3 family transposase | - |
ORI87_RS23640 (ORI87_23640) | 160946..161968 | - | 1023 | WP_131079334.1 | porphobilinogen synthase | - |
ORI87_RS23645 (ORI87_23645) | 162032..163378 | - | 1347 | WP_011154555.1 | dihydroorotase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 | 1..226559 | 226559 | |
- | inside | IScluster/Tn | - | - | 153228..160380 | 7152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T264798 WP_004098919.1 NZ_CP111009:158250-158732 [Escherichia coli]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J5Q928 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D3T1D0 |