Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 75399..76309 Replicon plasmid p130-1
Accession NZ_CP111009
Organism Escherichia coli strain J53-p130

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag ORI87_RS23195 Protein ID WP_004026354.1
Coordinates 75839..76309 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag ORI87_RS23190 Protein ID WP_004026357.1
Coordinates 75399..75842 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI87_RS23160 (ORI87_23160) 70417..70938 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
ORI87_RS23165 (ORI87_23165) 70935..71888 + 954 Protein_75 fec operon regulator FecR -
ORI87_RS23170 (ORI87_23170) 71975..74101 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
ORI87_RS23175 (ORI87_23175) 74176..74295 + 120 Protein_77 Fe3+-citrate ABC transporter substrate-binding protein -
ORI87_RS23180 (ORI87_23180) 74476..74697 + 222 WP_004213643.1 DUF2188 domain-containing protein -
ORI87_RS23185 (ORI87_23185) 74795..75298 + 504 Protein_79 DUF4113 domain-containing protein -
ORI87_RS23190 (ORI87_23190) 75399..75842 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
ORI87_RS23195 (ORI87_23195) 75839..76309 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
ORI87_RS23200 (ORI87_23200) 76764..76952 - 189 WP_223271245.1 hypothetical protein -
ORI87_RS23205 (ORI87_23205) 77566..77826 - 261 WP_004026352.1 hypothetical protein -
ORI87_RS23210 (ORI87_23210) 78397..79578 - 1182 WP_004883380.1 IS481 family transposase -
ORI87_RS23215 (ORI87_23215) 79650..79808 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
ORI87_RS23220 (ORI87_23220) 80187..80429 - 243 WP_071826037.1 hypothetical protein -
ORI87_RS23225 (ORI87_23225) 80505..80669 - 165 WP_011154586.1 hypothetical protein -
ORI87_RS23230 (ORI87_23230) 80786..80947 - 162 WP_164507110.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 1..226559 226559
- flank IS/Tn - - 78397..79578 1181


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T264797 WP_004026354.1 NZ_CP111009:75839-76309 [Escherichia coli]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT264797 WP_004026357.1 NZ_CP111009:75399-75842 [Escherichia coli]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References