Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 12234..12985 | Replicon | plasmid p130-1 |
Accession | NZ_CP111009 | ||
Organism | Escherichia coli strain J53-p130 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | ORI87_RS22850 | Protein ID | WP_004902249.1 |
Coordinates | 12234..12716 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | ORI87_RS22855 | Protein ID | WP_004902250.1 |
Coordinates | 12707..12985 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI87_RS22830 (ORI87_22830) | 8633..9280 | - | 648 | WP_014386537.1 | EcsC family protein | - |
ORI87_RS22835 (ORI87_22835) | 9307..10062 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
ORI87_RS22840 (ORI87_22840) | 10163..10555 | - | 393 | WP_045145491.1 | hypothetical protein | - |
ORI87_RS22845 (ORI87_22845) | 10660..11199 | - | 540 | WP_004902239.1 | hypothetical protein | - |
ORI87_RS22850 (ORI87_22850) | 12234..12716 | - | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | Toxin |
ORI87_RS22855 (ORI87_22855) | 12707..12985 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
ORI87_RS22860 (ORI87_22860) | 13104..13316 | - | 213 | WP_266051389.1 | hypothetical protein | - |
ORI87_RS22865 (ORI87_22865) | 13424..13765 | - | 342 | WP_004902257.1 | hypothetical protein | - |
ORI87_RS22870 (ORI87_22870) | 14539..14649 | + | 111 | Protein_16 | glutathione ABC transporter permease GsiC | - |
ORI87_RS22875 (ORI87_22875) | 14733..16403 | - | 1671 | WP_004902261.1 | AMP-binding protein | - |
ORI87_RS22880 (ORI87_22880) | 16384..17649 | - | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
ORI87_RS22885 (ORI87_22885) | 17667..17957 | - | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 | 1..226559 | 226559 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17689.52 Da Isoelectric Point: 9.2033
>T264796 WP_004902249.1 NZ_CP111009:c12716-12234 [Escherichia coli]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|