Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3311473..3312091 | Replicon | chromosome |
| Accession | NZ_CP111008 | ||
| Organism | Escherichia coli strain J53-p130 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | ORI87_RS16305 | Protein ID | WP_001291435.1 |
| Coordinates | 3311873..3312091 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | ORI87_RS16300 | Protein ID | WP_000344800.1 |
| Coordinates | 3311473..3311847 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI87_RS16290 (3306562) | 3306562..3307755 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| ORI87_RS16295 (3307778) | 3307778..3310927 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| ORI87_RS16300 (3311473) | 3311473..3311847 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| ORI87_RS16305 (3311873) | 3311873..3312091 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| ORI87_RS16310 (3312263) | 3312263..3312814 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| ORI87_RS16315 (3312930) | 3312930..3313400 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| ORI87_RS16320 (3313564) | 3313564..3315114 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| ORI87_RS16325 (3315156) | 3315156..3315509 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| ORI87_RS16335 (3315888) | 3315888..3316199 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| ORI87_RS16340 (3316230) | 3316230..3316802 | - | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T264787 WP_001291435.1 NZ_CP111008:3311873-3312091 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT264787 WP_000344800.1 NZ_CP111008:3311473-3311847 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |